an online Instagram web viewer

#controlled medias

Photos

In comment write what is your opinion about this machine!? And tag your friends 🤠
Kuhn Smart Ploughing Controlled by GPS
#kuhn #smart #plough #controlled #by #gps #innovation #silver #medal #agritechnica #tractortest #tractortestcom
@keke_wyatt vocals are sooooo damn disrespectfuuuul! #effortless #controlled 🔊🔊🔊🔊🔥
⚜ #LIFE IS #TO BE #LIVED NOT #TO BE #CONTROLLED ⚜❤
🔥Here we are ladies and gents, great post by miss @sarahdufflifestyleandfitness have a gander on this bad boy 💪
.
.
Repost from @sarahdufflifestyleandfitness using @RepostRegramApp - .
.
💥Controlled eating, we all know we should but it isn’t always easy. Here’s some things to will hopefully give a heightened awareness of your actions & help you keep it real.
-
😊Important to think about why you’re eating if you can connect with this you’re immediately more in the drivers seat, be truthful so you can deal with.
-
😍Food adverts you see on billboards, on the TV / cinema screens advertising are specifically designed to trigger you into fantasying about food & although you may not realise it, it could be sub consciously driving you to eat certain foods. “Ooo all of a sudden I fancy a burger” - thinks the persons who saw 3 burger adverts that day, so I’m not saying run out of the room screaming when a food advert comes on just have an awareness of why you might be thinking or craving a food.
-
😀God dam you Cinnabon,I’ve spent enough time in the USA to know how heavily alluring that smell is & how it fills every single shopping mall. In the Uk it’s the supermarket pastry section which honestly makes me weak at the knees every now gain I’ll partake but If you’re easily drawn into this seduction & regularly succumb then probably best to avoid where possible, maybe wear a peg on your nose.
-
😁I always say to my online clients picture if they are trying to decide if they should eat something  or not, how are you going to feel when you’ve eaten it? They should always ensure its totally worth it if it’s not then perhaps best not to have it.
-
😎The no packet rule, if you can’t see the food in-front of you then you literally have no sense of how much you’re eating, & because quite often we eat till the food is gone, if you’re chowing down on a big bag of crisps then that be a HUGE portion.
-
🤩This isn’t original, & won’t be new to anyone but, protein & veg at every meal will 100 percent help to keep you in control.
-
❤️ I’m hungry so I’m off to eat 😁Questions let know feel free to share.
🔥Here we are ladies and gents, great post by miss @sarahdufflifestyleandfitness have a gander on this bad boy 💪 . . Repost from @sarahdufflifestyleandfitness using @RepostRegramApp - . . 💥Controlled eating, we all know we should but it isn’t always easy. Here’s some things to will hopefully give a heightened awareness of your actions & help you keep it real. - 😊Important to think about why you’re eating if you can connect with this you’re immediately more in the drivers seat, be truthful so you can deal with. - 😍Food adverts you see on billboards, on the TV / cinema screens advertising are specifically designed to trigger you into fantasying about food & although you may not realise it, it could be sub consciously driving you to eat certain foods. “Ooo all of a sudden I fancy a burger” - thinks the persons who saw 3 burger adverts that day, so I’m not saying run out of the room screaming when a food advert comes on just have an awareness of why you might be thinking or craving a food. - 😀God dam you Cinnabon,I’ve spent enough time in the USA to know how heavily alluring that smell is & how it fills every single shopping mall. In the Uk it’s the supermarket pastry section which honestly makes me weak at the knees every now gain I’ll partake but If you’re easily drawn into this seduction & regularly succumb then probably best to avoid where possible, maybe wear a peg on your nose. - 😁I always say to my online clients picture if they are trying to decide if they should eat something or not, how are you going to feel when you’ve eaten it? They should always ensure its totally worth it if it’s not then perhaps best not to have it. - 😎The no packet rule, if you can’t see the food in-front of you then you literally have no sense of how much you’re eating, & because quite often we eat till the food is gone, if you’re chowing down on a big bag of crisps then that be a HUGE portion. - 🤩This isn’t original, & won’t be new to anyone but, protein & veg at every meal will 100 percent help to keep you in control. - ❤️ I’m hungry so I’m off to eat 😁Questions let know feel free to share.
Everything is about to ship out. If you still want something before the holidays are over, now’s the time to jump over to our shop and snag one of the remaining pieces. Use code INTERSECT and we will pay for shipping. #linkinbio
Everything is about to ship out. If you still want something before the holidays are over, now’s the time to jump over to our shop and snag one of the remaining pieces. Use code INTERSECT and we will pay for shipping. #linkinbio 
A couple weeks out sitting at 177 feeling great. Fast as lightning! Figuring this body out. Comfortable in any situation. #Experience #Understanding #Strength #Wisdom #Guidance #SheerWill #Drive #Knowledge #Power #Equipped #Calm #Collected #Controlled #Platinum
Choose a system that works for you!
▪️
▫️
▪️
▫️
▪️
Carb Cycling? Intermittent Fasting?
Vegan? Vegetarian? Keto? 🧐🤔
Choose a system that works for you! ▪️ ▫️ ▪️ ▫️ ▪️ Carb Cycling? Intermittent Fasting? Vegan? Vegetarian? Keto? 🧐🤔
A 30 seconds walk from the shopping centre in Sunderland, means no last minute Xmas shopping! 🎄⛄️🛍#makespace #cityliving
A 30 seconds walk from the shopping centre in Sunderland, means no last minute Xmas shopping! 🎄⛄️🛍#makespace  #cityliving 
S M O O T H
•
Athlete Marek @flaggingflapper keeping it calm and cool. Such a sleek and controlled style of climbing 👐👏
•
Hand crafted training equipment @
www.dragonholds.co.uk
Link in bio
.
.
.
.
.
#dragonholds #climbing #beastmode #strong #athlete #passion #dedicated #climbingwall #climbvalley #controlled #bouldering #watch #delicate #training #climbingholds #northwales #uk #madeinbritain
@k9raf doing #controlled #concentrationcurls 4 the #biceps #arms -no help from the leg, #isolating #nomomentum #armworkout #nobouncing #nojerking
Head movement & body shots drill with me old China plate @jyoungfitness
.
.
I'm popping out the jab and Jordan is using head movement and footwork to avoid and move in to land body shots.
It's a good drill... try it!!!
.
.
.
.
#headmovement #bodyshots #footwork #boxing #fighter #guyswhobox #practice #controlled #movement #kravmaga #muaythai #selfdefence #kickboxing #martialarts #mma #ufc #skills #passion #noquit #sweat #fitness #tekkers #timing #instructor #ukfitspo #ukfitfam #training #gymlife #videooftheday #kravmaganorthldn
Head movement & body shots drill with me old China plate @jyoungfitness . . I'm popping out the jab and Jordan is using head movement and footwork to avoid and move in to land body shots. It's a good drill... try it!!! . . . . #headmovement  #bodyshots  #footwork  #boxing  #fighter  #guyswhobox  #practice  #controlled  #movement  #kravmaga  #muaythai  #selfdefence  #kickboxing  #martialarts  #mma  #ufc  #skills  #passion  #noquit  #sweat  #fitness  #tekkers  #timing  #instructor  #ukfitspo  #ukfitfam  #training  #gymlife  #videooftheday  #kravmaganorthldn 
Everything is about to ship out. If you still want something before the holidays are over, now’s the time to jump over to our shop and snag one of the remaining pieces. Use code INTERSECT and we will pay for shipping. #linkinbio
Everything is about to ship out. If you still want something before the holidays are over, now’s the time to jump over to our shop and snag one of the remaining pieces. Use code INTERSECT and we will pay for shipping. #linkinbio 
Marblestone working that back on tonight’s workout, slow is smooth, smooth is controlled, you don’t need to lift super heavy to put on size. High rep with a weight that challenges you will get the job done nicely. Correct form and controlled movement= gainz😏💥
-
#fitnessmotivation #fitness #nutraone #eas #military #militarymuscle #armystrong #protein #mesomorph #anabolicwarfare #size #controlled #movement #gainz #sup #reps #bodybuilding #sizematters #motivatedmonday #backworkout
Marblestone working that back on tonight’s workout, slow is smooth, smooth is controlled, you don’t need to lift super heavy to put on size. High rep with a weight that challenges you will get the job done nicely. Correct form and controlled movement= gainz😏💥 - #fitnessmotivation  #fitness  #nutraone  #eas  #military  #militarymuscle  #armystrong  #protein  #mesomorph  #anabolicwarfare  #size  #controlled  #movement  #gainz  #sup  #reps  #bodybuilding  #sizematters  #motivatedmonday  #backworkout 
just for fun #handstand on top of #building or #acrobat on #rooftop or #controlled #onehand high standard or whatever u like 😁 #acrobatics4ever #lovethemusic @valhalla_stunts
#fire.. or #controlled #destruction.. #true or #na
🥁#Dw #drumm #vicfirt #pearl #zildijan #export #Remo #Aquarian #controlled #instagood  #instagram #bateristas #FG #SNARE #Like #commentforcomment  #compartir @pearl_drums  @dwdrums_latinoamerica #Dw  @dwdrums  @remopercussion  @aquariandrumheads  @zildjiancompany @zildjian_latinoamerica  @instagram @shumart19  @drumhood  #shure  #bateria  #baterista  #yamahar6 #audio #hearts #in #earringswag #dru #newyork #foto #stk #stlouismodelshoot
Finish off with these 2 chest exercises ✔️
-
#fitness #chest #motivation #controlled #hardwork #passion #decdication #motivation #pt #personaltrainer #fitfam
The FCC is voting to end net neutrality on Dec. 14th (2 days away people!!!) Congress can still stop the vote, but only if we make them. 
Go to www.battleforthenet.com to #StoptheFCC and defend net neutrality before it's too late. 
Write your Congressmen
Call your Congressman. 
REPOST 
Be MAD as hell, our children will thank us for it.
THIS WILL EFFECT EVERY SINGLE ONE OF US ON HERE.

#FCC
#NetNeutrality #USCongressmen 
#StoptheFCC #SaveNetNeutrality
The FCC is voting to end net neutrality on Dec. 14th (2 days away people!!!) Congress can still stop the vote, but only if we make them. Go to www.battleforthenet.com to #StoptheFCC  and defend net neutrality before it's too late. Write your Congressmen Call your Congressman. REPOST Be MAD as hell, our children will thank us for it. THIS WILL EFFECT EVERY SINGLE ONE OF US ON HERE. #FCC  #NetNeutrality  #USCongressmen  #StoptheFCC  #SaveNetNeutrality 
⚜ #LIFE IS #TO BE #LIVED NOT #TO BE #CONTROLLED ⚜❤
KILLED back today! Feeling really good right now, nutrition is on point, workouts are going great! Finishing 2017 STRONG! 💪🏽😊 #progress #physique #update #backday #ootd #videooftheday #mondaymotivation #bodybuilding #weightlifting #fitgirl #fitfam #fitbody #fitchick #fitness #bossbabe #pumped #slow #controlled #fitnesslifestyle #fitnessjourney #weightloss #muscle #gainz #girlswholift #iifym #iifymgirls #regimerepublic #goodafternoon #longhairdontcare #watchmework
KILLED back today! Feeling really good right now, nutrition is on point, workouts are going great! Finishing 2017 STRONG! 💪🏽😊 #progress  #physique  #update  #backday  #ootd  #videooftheday  #mondaymotivation  #bodybuilding  #weightlifting  #fitgirl  #fitfam  #fitbody  #fitchick  #fitness  #bossbabe  #pumped  #slow  #controlled  #fitnesslifestyle  #fitnessjourney  #weightloss  #muscle  #gainz  #girlswholift  #iifym  #iifymgirls  #regimerepublic  #goodafternoon  #longhairdontcare  #watchmework 
So many lost souls out there in human form that know nothing yet of the real world and what's really going on deep behind the scenes of the cruelty of this worlds powers n governments just living day by day like slaves being controlled w out even knowing so feeling lost, alone, stressed, mad anxious, or worried whatever it is u name it but life shouldn't be like that the struggles is a must u just make it a struggle ur life is ur destiny we don't get to choose who we Wana b when were born so make the best of it everyday should be lived happy no matter what make this ur heaven or hell kus now is when u know ur alive fuck the after life religion bs that was also created to control. keep that stressed head up high b positive and just b happy now and start being aware of how life should be like and live like it should be lived ! #life #controlled #free #spirit #souls #dreamstate #trancefam #woke #wokeaf #wokefam #electricempire #psychedelics
So many lost souls out there in human form that know nothing yet of the real world and what's really going on deep behind the scenes of the cruelty of this worlds powers n governments just living day by day like slaves being controlled w out even knowing so feeling lost, alone, stressed, mad anxious, or worried whatever it is u name it but life shouldn't be like that the struggles is a must u just make it a struggle ur life is ur destiny we don't get to choose who we Wana b when were born so make the best of it everyday should be lived happy no matter what make this ur heaven or hell kus now is when u know ur alive fuck the after life religion bs that was also created to control. keep that stressed head up high b positive and just b happy now and start being aware of how life should be like and live like it should be lived ! #life  #controlled  #free  #spirit  #souls  #dreamstate  #trancefam  #woke  #wokeaf  #wokefam  #electricempire  #psychedelics 
When your not ready to be recorded lol #lightweightfeltlikeheavyweight#zactionfitness#slow#controlled#legpressmachine#legday#live#laugh#train👊🏽
In comment write what is your opinion about this machine!? And tag your friends 🤠
Kuhn Smart Ploughing Controlled by GPS
#kuhn #smart #plough #controlled #by #gps #innovation #silver #medal #agritechnica #tractortest #tractortestcom
#repost @theuniversityofsheffield The snow in Sheffield is giving us all of the Christmassy feels!🎄♥️☃️ #sheffield #sunderland #cityliving
The 2-In-1 RGB LED Kit Installed In A Chevy Avalanche , nicely installed an just flat out looks amazing ! #conceptjunkiez #rgbled #rgb #led #lights #multicolor #bluetooth #controlled #hottesttrends
mini pivots 🤔my clutch skills are slowly coming along, feels really rewarding getting the bike where it needs to be with proper clutch and throttle control... i’m far from mastering it but “clutch control” is key!!! #minipivots #controlled #imgettingthere #rocks #mcnutt #klimlife #clutchcontrol #smoothiskey #4strokesarenotlife #besmoothnotwreckless #itsthelittlethings
Man Utd 1-2 Man City
Frustrating Manchester Derby. We defended horribly in their set pieces, which led to their two goals. De Bruyne and Silva ran riot in City’s midfield and we couldn’t do anything about it because they controlled the game. Our midfield definitely needs working on.
#lost #1 #goal #home #oldtrafford #loss #manchesterderby #derby #rivals #enemies #manchestercity #city #frustrating #goals #debruyne #silva #controlled #midfield #match #game #matchday #manchester #manchesterunited #manunited #manutd #manu #mufc #united #reddevils #ggmu
Man Utd 1-2 Man City Frustrating Manchester Derby. We defended horribly in their set pieces, which led to their two goals. De Bruyne and Silva ran riot in City’s midfield and we couldn’t do anything about it because they controlled the game. Our midfield definitely needs working on. #lost  #1  #goal  #home  #oldtrafford  #loss  #manchesterderby  #derby  #rivals  #enemies  #manchestercity  #city  #frustrating  #goals  #debruyne  #silva  #controlled  #midfield  #match  #game  #matchday  #manchester  #manchesterunited  #manunited  #manutd  #manu  #mufc  #united  #reddevils  #ggmu 
🔥Here we are ladies and gents, great post by miss @sarahdufflifestyleandfitness have a gander on this bad boy 💪
.
.
Repost from @sarahdufflifestyleandfitness using @RepostRegramApp - .
.
💥Controlled eating, we all know we should but it isn’t always easy. Here’s some things to will hopefully give a heightened awareness of your actions & help you keep it real.
-
😊Important to think about why you’re eating if you can connect with this you’re immediately more in the drivers seat, be truthful so you can deal with.
-
😍Food adverts you see on billboards, on the TV / cinema screens advertising are specifically designed to trigger you into fantasying about food & although you may not realise it, it could be sub consciously driving you to eat certain foods. “Ooo all of a sudden I fancy a burger” - thinks the persons who saw 3 burger adverts that day, so I’m not saying run out of the room screaming when a food advert comes on just have an awareness of why you might be thinking or craving a food.
-
😀God dam you Cinnabon,I’ve spent enough time in the USA to know how heavily alluring that smell is & how it fills every single shopping mall. In the Uk it’s the supermarket pastry section which honestly makes me weak at the knees every now gain I’ll partake but If you’re easily drawn into this seduction & regularly succumb then probably best to avoid where possible, maybe wear a peg on your nose.
-
😁I always say to my online clients picture if they are trying to decide if they should eat something  or not, how are you going to feel when you’ve eaten it? They should always ensure its totally worth it if it’s not then perhaps best not to have it.
-
😎The no packet rule, if you can’t see the food in-front of you then you literally have no sense of how much you’re eating, & because quite often we eat till the food is gone, if you’re chowing down on a big bag of crisps then that be a HUGE portion.
-
🤩This isn’t original, & won’t be new to anyone but, protein & veg at every meal will 100 percent help to keep you in control.
-
❤️ I’m hungry so I’m off to eat 😁Questions let know feel free to share.
🔥Here we are ladies and gents, great post by miss @sarahdufflifestyleandfitness have a gander on this bad boy 💪 . . Repost from @sarahdufflifestyleandfitness using @RepostRegramApp - . . 💥Controlled eating, we all know we should but it isn’t always easy. Here’s some things to will hopefully give a heightened awareness of your actions & help you keep it real. - 😊Important to think about why you’re eating if you can connect with this you’re immediately more in the drivers seat, be truthful so you can deal with. - 😍Food adverts you see on billboards, on the TV / cinema screens advertising are specifically designed to trigger you into fantasying about food & although you may not realise it, it could be sub consciously driving you to eat certain foods. “Ooo all of a sudden I fancy a burger” - thinks the persons who saw 3 burger adverts that day, so I’m not saying run out of the room screaming when a food advert comes on just have an awareness of why you might be thinking or craving a food. - 😀God dam you Cinnabon,I’ve spent enough time in the USA to know how heavily alluring that smell is & how it fills every single shopping mall. In the Uk it’s the supermarket pastry section which honestly makes me weak at the knees every now gain I’ll partake but If you’re easily drawn into this seduction & regularly succumb then probably best to avoid where possible, maybe wear a peg on your nose. - 😁I always say to my online clients picture if they are trying to decide if they should eat something or not, how are you going to feel when you’ve eaten it? They should always ensure its totally worth it if it’s not then perhaps best not to have it. - 😎The no packet rule, if you can’t see the food in-front of you then you literally have no sense of how much you’re eating, & because quite often we eat till the food is gone, if you’re chowing down on a big bag of crisps then that be a HUGE portion. - 🤩This isn’t original, & won’t be new to anyone but, protein & veg at every meal will 100 percent help to keep you in control. - ❤️ I’m hungry so I’m off to eat 😁Questions let know feel free to share.
3x8 on 315lb beltless deadlifts w/ slow and controlled movements, to really focus on hitting lower back. (Last set, loose shoes, and 3rd day for my back. 😶) but fuck excuses I’m still hittin it, I am tore up, definantly taking a break from back for a few days though lol 😬 #powerlifter #powerlifting #bodybuilding #deadlifting #reps #controlled #sbd #manimal #instafit #instafitness #markbell #fromdusktilldawn 🏋🏽💪🏼
Because you needed this kind of energy today🙌🏾🙌🏾🙌🏾Yas God. Ain’t nobody messing with KeKe’s vocals now, I don’t care. I feel like everytime she has another baby her vocal range expands just that much more lmao. She betta saaaaaaang hunny! #Repost @teedramoses (@get_repost)
・・・
@keke_wyatt vocals are sooooo damn disrespectfuuuul! #effortless #controlled 🔊🔊🔊🔊🔥#music#energy#AllTheFeels#HighNotes#range#SoundHealing
Because you needed this kind of energy today🙌🏾🙌🏾🙌🏾Yas God. Ain’t nobody messing with KeKe’s vocals now, I don’t care. I feel like everytime she has another baby her vocal range expands just that much more lmao. She betta saaaaaaang hunny! #Repost  @teedramoses (@get_repost) ・・・ @keke_wyatt vocals are sooooo damn disrespectfuuuul! #effortless  #controlled  🔊🔊🔊🔊🔥#music #energy #AllTheFeels #HighNotes #range #SoundHealing