an online Instagram web viewer

#diyetyemektarifleri medias

Photos

­čŹź├çikolatadan ,tatl─▒dan vazge├žemeyen ama diyet yapan takip├žilerimin yard─▒m─▒na ko┼čuyorum­čśś­čĹç­čĆ╝­čĹç­čĆ╝­čĹç­čĆ╝
Haydi tarife ge├želim­čĹç­čĆ╝­čĹç­čĆ╝­čĹç­čĆ╝ Diyet Kurabiye Tarifi­čÄŐ
Malzemeler: ­čÄÇ2 adet yumurta ­čÄÇ1 ├žay fincan─▒ toz ┼čeker ­čÄÇ1 ├žay fincan─▒ s─▒v─▒ ya─č ­čÄÇ2 yemek ka┼č─▒─č─▒ kakao ­čÄÇ2 ├žay fincan─▒ kepekli un ­čÄÇ1 paket kabartma tozu ­čÄÇ1 paket vanilya ­čÄÇ3 yemek ka┼č─▒─č─▒ damla ├žikolata
~*~*~*~*~*~*~*^_^~*~*~*~
Haz─▒rlan─▒┼č─▒:
Bir kar─▒┼čt─▒rma kab─▒na yumurtalar─▒ k─▒ral─▒m, ┼čekeri de ekleyerek, ┼čeker eriyene dek ├ž─▒rpal─▒m. Ard─▒ndan s─▒v─▒ ya─č─▒,kakaoyu,kepekli unu,kabartma tozunu,vanilyay─▒ ve damla ├žikolatalar─▒ birer birer ekleyelim. Yumu┼čak bir hamur oluncaya kadar yo─čural─▒m. Hamurdan ceviz b├╝y├╝kl├╝─č├╝nde par├žalar kopartal─▒m ve yuvarlayal─▒m. Ya─čl─▒ ka─č─▒t serdi─čimiz f─▒r─▒n tepsisine dizelim. 160 derecelik f─▒r─▒nda pi┼čirelim. Afiyetler olsunnÔŁĄ´ŞĆ
#tatl─▒ #diyettarifler #tatl─▒tarifleri #yemektarifleri #tatl─▒krizi #├žikolata #chocolate #diyethesaplaritakiplesiyor #gt #diyet #diyethesaplar─▒ #diyethesaplar─▒takiplesiyor #diyetisyen #diyetisyenhesaplaritakiplesiyor #diyetisyenneyer #diyetisyenizmir #diyettatli #tatlitarifleri #kurabiyetarifleri #├žikolatal─▒ #diyetgrubu #diyetko├žu #zay─▒flama #diyetlistesi #diyette #diyetteyizekibi #diyetisyenankara #diyetyemektarifleri #diyettakip
­čŹź├çikolatadan ,tatl─▒dan vazge├žemeyen ama diyet yapan takip├žilerimin yard─▒m─▒na ko┼čuyorum­čśś­čĹç­čĆ╝­čĹç­čĆ╝­čĹç­čĆ╝ Haydi tarife ge├želim­čĹç­čĆ╝­čĹç­čĆ╝­čĹç­čĆ╝ Diyet Kurabiye Tarifi­čÄŐ Malzemeler: ­čÄÇ2 adet yumurta ­čÄÇ1 ├žay fincan─▒ toz ┼čeker ­čÄÇ1 ├žay fincan─▒ s─▒v─▒ ya─č ­čÄÇ2 yemek ka┼č─▒─č─▒ kakao ­čÄÇ2 ├žay fincan─▒ kepekli un ­čÄÇ1 paket kabartma tozu ­čÄÇ1 paket vanilya ­čÄÇ3 yemek ka┼č─▒─č─▒ damla ├žikolata ~*~*~*~*~*~*~*^_^~*~*~*~ Haz─▒rlan─▒┼č─▒: Bir kar─▒┼čt─▒rma kab─▒na yumurtalar─▒ k─▒ral─▒m, ┼čekeri de ekleyerek, ┼čeker eriyene dek ├ž─▒rpal─▒m. Ard─▒ndan s─▒v─▒ ya─č─▒,kakaoyu,kepekli unu,kabartma tozunu,vanilyay─▒ ve damla ├žikolatalar─▒ birer birer ekleyelim. Yumu┼čak bir hamur oluncaya kadar yo─čural─▒m. Hamurdan ceviz b├╝y├╝kl├╝─č├╝nde par├žalar kopartal─▒m ve yuvarlayal─▒m. Ya─čl─▒ ka─č─▒t serdi─čimiz f─▒r─▒n tepsisine dizelim. 160 derecelik f─▒r─▒nda pi┼čirelim. Afiyetler olsunnÔŁĄ´ŞĆ #tatl─▒  #diyettarifler  #tatl─▒tarifleri  #yemektarifleri  #tatl─▒krizi  #├žikolata  #chocolate  #diyethesaplaritakiplesiyor  #gt  #diyet  #diyethesaplar─▒  #diyethesaplar─▒takiplesiyor  #diyetisyen  #diyetisyenhesaplaritakiplesiyor  #diyetisyenneyer  #diyetisyenizmir  #diyettatli  #tatlitarifleri  #kurabiyetarifleri  #├žikolatal─▒  #diyetgrubu  #diyetko├žu  #zay─▒flama  #diyetlistesi  #diyette  #diyetteyizekibi  #diyetisyenankara  #diyetyemektarifleri  #diyettakip 
Haftan─▒n tarifi bug├╝n #cips sevenler i├žin geldi ­č弭čĺĽak┼čamlar─▒ uzan─▒p film izlerken bi┼čeyler at─▒┼čt─▒rmak sizin i├žin bir keyifse biz bu keyfinize engel olmaktansa destek olmaya ├žal─▒┼č─▒yoruz. Porsiyon miktar─▒na dikkat etti─činiz s├╝rece bu cipsleri #g├╝venlibesin sayabiliriz. 
Yap─▒m─▒da di─čer tarifler gibi olduk├žaa basit ­čĹî­čĆ╗un yo─čurt gerekirse suyla hamurunuzu olu┼čturduktan sonra ├╝├žgen yuvarlak vb ┼čekillerde neredeyse 80-85 adet cips tanesi elde edip ├╝zerine baharat  ekledi─činiz zeytinya─č─▒n─▒ s├╝r├╝n ve 200 derecede ├ž─▒t─▒rla┼čana kadar pi┼čirin, tek ba┼č─▒na ya da yo─čurt domates sosuna banarak t├╝ketebilirsiniz­čĹî­čĆ╗­čĹî­čĆ╗biz bug├╝n hocalar─▒m─▒zla dan─▒┼čanlar─▒m─▒zla ├žal─▒┼čanlar─▒m─▒zla afiyetle yedik ­č弭čĺĽsizlere de afiyet olsun­čĄŚ­čĄŚ
hamur yapmakla u─čra┼čmak istemeyenler i├žin kepekli lava┼č kullan─▒labilir­čĄŚ #diyetara├Â─č├╝n #diyetisyen #diyetisyensedabildiren #eatcleantraindirty #diyetyemekleri #diyetyemektarifleri #sporcubeslenmesi #fitness #muscle #kozawos #bah├že┼čehir #akbat─▒ #kozaevleri #athlete #detox #detoxjuices #protein #karbonhidrat #ara├Â─č├╝n
Haftan─▒n tarifi bug├╝n #cips  sevenler i├žin geldi ­č弭čĺĽak┼čamlar─▒ uzan─▒p film izlerken bi┼čeyler at─▒┼čt─▒rmak sizin i├žin bir keyifse biz bu keyfinize engel olmaktansa destek olmaya ├žal─▒┼č─▒yoruz. Porsiyon miktar─▒na dikkat etti─činiz s├╝rece bu cipsleri #g├╝venlibesin  sayabiliriz. Yap─▒m─▒da di─čer tarifler gibi olduk├žaa basit ­čĹî­čĆ╗un yo─čurt gerekirse suyla hamurunuzu olu┼čturduktan sonra ├╝├žgen yuvarlak vb ┼čekillerde neredeyse 80-85 adet cips tanesi elde edip ├╝zerine baharat ekledi─činiz zeytinya─č─▒n─▒ s├╝r├╝n ve 200 derecede ├ž─▒t─▒rla┼čana kadar pi┼čirin, tek ba┼č─▒na ya da yo─čurt domates sosuna banarak t├╝ketebilirsiniz­čĹî­čĆ╗­čĹî­čĆ╗biz bug├╝n hocalar─▒m─▒zla dan─▒┼čanlar─▒m─▒zla ├žal─▒┼čanlar─▒m─▒zla afiyetle yedik ­č弭čĺĽsizlere de afiyet olsun­čĄŚ­čĄŚ hamur yapmakla u─čra┼čmak istemeyenler i├žin kepekli lava┼č kullan─▒labilir­čĄŚ #diyetara├Â─č├╝n  #diyetisyen  #diyetisyensedabildiren  #eatcleantraindirty  #diyetyemekleri  #diyetyemektarifleri  #sporcubeslenmesi  #fitness  #muscle  #kozawos  #bah├že┼čehir  #akbat─▒  #kozaevleri  #athlete  #detox  #detoxjuices  #protein  #karbonhidrat  #ara├Â─č├╝n 
F─▒r─▒nda m├╝cver hem sa─čl─▒kl─▒ hem de tad─▒ nefis ­čĄô diyet yapanlar ├╝┼čenmesin yaps─▒n ­čść ihtiyac─▒m─▒z olanlar ise *3-4 kabak *1 adet havu├ž *1 adet so─čan *2 yumurta *100 gr light beyaz peynir *tuz,karabiber *2 yemek ka┼č─▒─č─▒ zeytinya─č─▒ *2 yemek ka┼č─▒─č─▒ tam bu─čday un *1 tutam dereotu  So─čan─▒,kaba─č─▒,havucu rendele ve di─čer malzemelerle bir kapta kar─▒┼čt─▒r. Kar─▒┼č─▒m─▒ top top k├Âfte gibi yap─▒p tepsiye yerle┼čtir tabi pi┼čirme ka─č─▒d─▒n─▒ tepsinin ├╝zerine yerle┼čtirmeyi unutmayal─▒m ­čśČ 40 dakka ├╝zeri haf─▒f k─▒zarana kadar 180 derecelik f─▒r─▒nda pi┼čirelim fit ve f─▒st─▒k olal─▒m ­čśů afiyetler olsun ­čśśtarif i├žin can─▒mm @damlaadinc E ├žok te┼čekk├╝r ederim ­čśś #yemektarifleri #diyet #diyetyemekleri #spor #sebzeyemekleri #healthyfood #diet #pilates #diyetyemektarifleri
F─▒r─▒nda m├╝cver hem sa─čl─▒kl─▒ hem de tad─▒ nefis ­čĄô diyet yapanlar ├╝┼čenmesin yaps─▒n ­čść ihtiyac─▒m─▒z olanlar ise *3-4 kabak *1 adet havu├ž *1 adet so─čan *2 yumurta *100 gr light beyaz peynir *tuz,karabiber *2 yemek ka┼č─▒─č─▒ zeytinya─č─▒ *2 yemek ka┼č─▒─č─▒ tam bu─čday un *1 tutam dereotu So─čan─▒,kaba─č─▒,havucu rendele ve di─čer malzemelerle bir kapta kar─▒┼čt─▒r. Kar─▒┼č─▒m─▒ top top k├Âfte gibi yap─▒p tepsiye yerle┼čtir tabi pi┼čirme ka─č─▒d─▒n─▒ tepsinin ├╝zerine yerle┼čtirmeyi unutmayal─▒m ­čśČ 40 dakka ├╝zeri haf─▒f k─▒zarana kadar 180 derecelik f─▒r─▒nda pi┼čirelim fit ve f─▒st─▒k olal─▒m ­čśů afiyetler olsun ­čśśtarif i├žin can─▒mm @damlaadinc E ├žok te┼čekk├╝r ederim ­čśś #yemektarifleri  #diyet  #diyetyemekleri  #spor  #sebzeyemekleri  #healthyfood  #diet  #pilates  #diyetyemektarifleri 
Minik bir tavsiyeyle yeniden merhaba­čÖő­čĆ╗
Ben yar─▒n itibariyle i┼č ba┼č─▒ yapt─▒─č─▒m i├žin ┼čimdiden kendime be┼č g├╝nl├╝k ara ├Â─č├╝n/at─▒┼čt─▒rmal─▒klar─▒m─▒ haz─▒rlad─▒m. Benim i├žin en iyi, en kaliteli ara ├Â─č├╝n/at─▒┼čt─▒rmal─▒k ├ži─č kuruyemi┼č. Uzun s├╝re tok tuttu─ču kesin bilgi­čśë ├çi─č olmas─▒ ger├žekten ├Ânemli. Benimkilerin i├žinde eser miktarda kavrulmu┼č f─▒st─▒k var biliyorum ama onu da g├Ârmeyiverin can─▒m­čÖł Ayr─▒ca porsiyonum da fazla ├ž├╝nk├╝ biliyorum ki herkese da─č─▒t─▒cam yerken­čśů B├Âyle minik po┼četlere haz─▒rlamak ├žok pratik geliyor bana kuruyemi┼č i├žin, tam ├žantaya atmal─▒k­čÄĺ Afiyetle­čśő
Minik bir tavsiyeyle yeniden merhaba­čÖő­čĆ╗ Ben yar─▒n itibariyle i┼č ba┼č─▒ yapt─▒─č─▒m i├žin ┼čimdiden kendime be┼č g├╝nl├╝k ara ├Â─č├╝n/at─▒┼čt─▒rmal─▒klar─▒m─▒ haz─▒rlad─▒m. Benim i├žin en iyi, en kaliteli ara ├Â─č├╝n/at─▒┼čt─▒rmal─▒k ├ži─č kuruyemi┼č. Uzun s├╝re tok tuttu─ču kesin bilgi­čśë ├çi─č olmas─▒ ger├žekten ├Ânemli. Benimkilerin i├žinde eser miktarda kavrulmu┼č f─▒st─▒k var biliyorum ama onu da g├Ârmeyiverin can─▒m­čÖł Ayr─▒ca porsiyonum da fazla ├ž├╝nk├╝ biliyorum ki herkese da─č─▒t─▒cam yerken­čśů B├Âyle minik po┼četlere haz─▒rlamak ├žok pratik geliyor bana kuruyemi┼č i├žin, tam ├žantaya atmal─▒k­čÄĺ Afiyetle­čśő
Selammm­čÖő­čĆ╗
Bug├╝n g├╝nlerden evde ekmek yap─▒m─▒­čĄś­čĆ╗
Benimki bu─čday ru┼čeymli ve chia tohumlu m─▒s─▒r ekme─či. Yap─▒m─▒ kolay, lezzeti vallahi olay­čśő Tarif sevgili @betella_ 'dan. ─░├žindekiler i├žin sa─ča kayd─▒rabilirsiniz. Detaylar i├žinse dooo─čru @betella_ 'yaÔÖą´ŞĆ
Selammm­čÖő­čĆ╗ Bug├╝n g├╝nlerden evde ekmek yap─▒m─▒­čĄś­čĆ╗ Benimki bu─čday ru┼čeymli ve chia tohumlu m─▒s─▒r ekme─či. Yap─▒m─▒ kolay, lezzeti vallahi olay­čśő Tarif sevgili @betella_ 'dan. ─░├žindekiler i├žin sa─ča kayd─▒rabilirsiniz. Detaylar i├žinse dooo─čru @betella_ 'yaÔÖą´ŞĆ
Bamya ve Yo─čurt Ôťů HAYD─░ BAMYANIN FAYDALARINA GE├çEL─░M ­čĹç­čĆ╝­čĹç­čĆ╝­čĹç­čĆ╝
Zay─▒flamay─▒ sa─člayan bamya t├╝ketimi cilde ve sa├žlara da iyi geliyor.
­čîŞBamyan─▒n lif i├žeri─či pek ├žok yararl─▒ niteliklere sahip olmas─▒n─▒ sa─člar ├Âzellikle mide ba─č─▒rsak sa─čl─▒─č─▒n─▒ korumaya yard─▒mc─▒ olur. Bamya suyu emmeye yard─▒mc─▒ olur ve a┼č─▒r─▒ kolesterol, metabolik toksinler ve a┼č─▒r─▒ safray─▒ yakalay─▒p d─▒┼čk─▒ yoluyla d─▒┼čar─▒ atar. ─░├žeri─čindeki b├╝y├╝k su y├╝zdesi kab─▒zl─▒k, gaz, ┼či┼čkinlik ve mide problemlerini ├Ânler. ­čîŞBamya g├╝nl├╝k lif ihtiyac─▒n─▒z─▒n %10 unu kar┼č─▒lar. D├╝┼č├╝k kalorisiyle diyet men├╝m├╝zden eksik etmememiz gerekir. 
#diyetisyen #diyetisyenler #diyet #diyetyemekleri #diyetkardesli─či #diyetisyenim #diyetvakti #diyettakip #diyetmen├╝ #diyetyemektarifleri #yemek #yemektarif #tarifdefteri #diyetteyim #kiloalmakistiyorum #kilo #kilonukontroletyolunubenden├Â─čren #kiloverme #zay─▒flama #zayiflama #zay─▒flamakistiyorum #zayiflamak #zayiflama #zayiflama #zay─▒f #yemekyemek #yemekye #yemekg├╝nl├╝─č├╝ #bamya #sa─čl─▒k #spora
Bamya ve Yo─čurt Ôťů HAYD─░ BAMYANIN FAYDALARINA GE├çEL─░M ­čĹç­čĆ╝­čĹç­čĆ╝­čĹç­čĆ╝ Zay─▒flamay─▒ sa─člayan bamya t├╝ketimi cilde ve sa├žlara da iyi geliyor. ­čîŞBamyan─▒n lif i├žeri─či pek ├žok yararl─▒ niteliklere sahip olmas─▒n─▒ sa─člar ├Âzellikle mide ba─č─▒rsak sa─čl─▒─č─▒n─▒ korumaya yard─▒mc─▒ olur. Bamya suyu emmeye yard─▒mc─▒ olur ve a┼č─▒r─▒ kolesterol, metabolik toksinler ve a┼č─▒r─▒ safray─▒ yakalay─▒p d─▒┼čk─▒ yoluyla d─▒┼čar─▒ atar. ─░├žeri─čindeki b├╝y├╝k su y├╝zdesi kab─▒zl─▒k, gaz, ┼či┼čkinlik ve mide problemlerini ├Ânler. ­čîŞBamya g├╝nl├╝k lif ihtiyac─▒n─▒z─▒n %10 unu kar┼č─▒lar. D├╝┼č├╝k kalorisiyle diyet men├╝m├╝zden eksik etmememiz gerekir. #diyetisyen  #diyetisyenler  #diyet  #diyetyemekleri  #diyetkardesli─či  #diyetisyenim  #diyetvakti  #diyettakip  #diyetmen├╝  #diyetyemektarifleri  #yemek  #yemektarif  #tarifdefteri  #diyetteyim  #kiloalmakistiyorum  #kilo  #kilonukontroletyolunubenden├Â─čren  #kiloverme  #zay─▒flama  #zayiflama  #zay─▒flamakistiyorum  #zayiflamak  #zayiflama  #zayiflama  #zay─▒f  #yemekyemek  #yemekye  #yemekg├╝nl├╝─č├╝  #bamya  #sa─čl─▒k  #spora 
Ta taammmm­čÄŐ­čÄŐ­čÄŐ
Bizzat ellerimle yapt─▒─č─▒m ev yo─čurdum misler gibi tutmuuu┼č­čĹî­čĆ╗ Olley!
Ta taammmm­čÄŐ­čÄŐ­čÄŐ Bizzat ellerimle yapt─▒─č─▒m ev yo─čurdum misler gibi tutmuuu┼č­čĹî­čĆ╗ Olley!
Sa─ča do─čru kayd─▒r─▒rsan─▒z s─▒ras─▒yla ak┼čam yeme─či>├Â─čle yeme─či>kahvalt─▒ ­čśő
ÔÇóSabahlar─▒m klasik benim. Ya bildi─činiz klasik domatesli zeytinli kahvalt─▒ ya da tost. ├ço─ču diyet sayfalar─▒n─▒ ve blogger kahvalt─▒lar─▒n─▒ s├╝sleyen o haval─▒ yulaf ezmeli kahvalt─▒lar hi├ž bi zaman benlik olmad─▒ malesef­čÖâ
ÔÇó├ľ─člen yemeklerinde pek bir ├Âzg├╝r├╝m bu ara ama ├Ân├╝m├╝zdeki hafta i┼če d├Ân├╝nce neler olacak bakal─▒m­čÖł bug├╝nk├╝ yo─čurtlu semiz otuydu ki son anda e┼čime yapt─▒─č─▒m yeme─čin etlerinden ├╝├ž be┼č par├ža a┼č─▒rm─▒┼č─▒m olabilirim­čÖł
ÔÇóAk┼čam yemeklerinde ise genelde bulgur pilav─▒ filan t├╝ketmemeye ├žal─▒┼č─▒yorum asl─▒nda ama bug├╝n b├Âle denk geldi. Zaten de az─▒c─▒k­čśů Sebzeli bulgur pilav─▒ ve k├Âzlenmi┼č ─▒zgaralanm─▒┼č sebzeler­čśë dipnot: Yediklerimi b├Âyle minik minik tabaklara koyunca ├žok yemi┼čim gibi gelio, psikolojime oynuyorum yani­čśë
Herkeslere afiyetler olsunÔÖą´ŞĆ
Sa─ča do─čru kayd─▒r─▒rsan─▒z s─▒ras─▒yla ak┼čam yeme─či>├Â─čle yeme─či>kahvalt─▒ ­čśő ÔÇóSabahlar─▒m klasik benim. Ya bildi─činiz klasik domatesli zeytinli kahvalt─▒ ya da tost. ├ço─ču diyet sayfalar─▒n─▒ ve blogger kahvalt─▒lar─▒n─▒ s├╝sleyen o haval─▒ yulaf ezmeli kahvalt─▒lar hi├ž bi zaman benlik olmad─▒ malesef­čÖâ ÔÇó├ľ─člen yemeklerinde pek bir ├Âzg├╝r├╝m bu ara ama ├Ân├╝m├╝zdeki hafta i┼če d├Ân├╝nce neler olacak bakal─▒m­čÖł bug├╝nk├╝ yo─čurtlu semiz otuydu ki son anda e┼čime yapt─▒─č─▒m yeme─čin etlerinden ├╝├ž be┼č par├ža a┼č─▒rm─▒┼č─▒m olabilirim­čÖł ÔÇóAk┼čam yemeklerinde ise genelde bulgur pilav─▒ filan t├╝ketmemeye ├žal─▒┼č─▒yorum asl─▒nda ama bug├╝n b├Âle denk geldi. Zaten de az─▒c─▒k­čśů Sebzeli bulgur pilav─▒ ve k├Âzlenmi┼č ─▒zgaralanm─▒┼č sebzeler­čśë dipnot: Yediklerimi b├Âyle minik minik tabaklara koyunca ├žok yemi┼čim gibi gelio, psikolojime oynuyorum yani­čśë Herkeslere afiyetler olsunÔÖą´ŞĆ
Yaz sonuna kadar vazge├žmeyece─čim tek yemek!­čî Ac─▒ yiyemesem de tatl─▒ oldu─ču s├╝rece t├╝m biberler benim a┼čk─▒mÔÖą´ŞĆ ├ľnceleri k─▒zartmas─▒na a┼č─▒kt─▒m ancak son zamanlarda ba┼člatt─▒─č─▒m sa─čl─▒kl─▒ beslenme ayaklanmas─▒yla f─▒r─▒n k├Âzleme is my fav­čśŹ
Yaz sonuna kadar vazge├žmeyece─čim tek yemek!­čî Ac─▒ yiyemesem de tatl─▒ oldu─ču s├╝rece t├╝m biberler benim a┼čk─▒mÔÖą´ŞĆ ├ľnceleri k─▒zartmas─▒na a┼č─▒kt─▒m ancak son zamanlarda ba┼člatt─▒─č─▒m sa─čl─▒kl─▒ beslenme ayaklanmas─▒yla f─▒r─▒n k├Âzleme is my fav­čśŹ
Evet biliyorum hepimize ├žok kolay geliyor et ya da tavuk suyu tabletlerden yemeklerimize at─▒vermek ama faydas─▒ndan ├žok zarar─▒ oldu─čunu hepimiz biliyoruz. Tek ha┼člamada bu kadar ├žok tablet ├ž─▒karken hem de­čś│ hem de en sa─čl─▒kl─▒s─▒ndan en temizinden en saf─▒ndanÔťî­čĆ╝
Po┼čet markas─▒ i├žin bkz foto 2­čśë
Evet biliyorum hepimize ├žok kolay geliyor et ya da tavuk suyu tabletlerden yemeklerimize at─▒vermek ama faydas─▒ndan ├žok zarar─▒ oldu─čunu hepimiz biliyoruz. Tek ha┼člamada bu kadar ├žok tablet ├ž─▒karken hem de­čś│ hem de en sa─čl─▒kl─▒s─▒ndan en temizinden en saf─▒ndanÔťî­čĆ╝ Po┼čet markas─▒ i├žin bkz foto 2­čśë
Evde granola da yapmadim demem artik­čÖĆ­čĆ╗­čśů­čśő ­čśő #granola #evyapimigranola #badem #yulaf #kabakcekirdegi #chia #kayisi #pekmez #bal #tarcin 180derecelik firinda hepsini karistirip 20dakika pisirin­čĹî­čĆ╗­čĹî­čĆ╗#delicious #healthyfood #saglikliyasam #healthylifestyle #eatclean #neyesek #kahvaltidaneyesek #pratikkahvalti #kahvalti├Ânerisi #breakfast #oatmeal #evyapimi #homemade #foodie #foodporn #instafood #bugunneyesek #diyetyemektarifleri #yummy
Evde granola da yapmadim demem artik­čÖĆ­čĆ╗­čśů­čśő ­čśő #granola  #evyapimigranola  #badem  #yulaf  #kabakcekirdegi  #chia  #kayisi  #pekmez  #bal  #tarcin  180derecelik firinda hepsini karistirip 20dakika pisirin­čĹî­čĆ╗­čĹî­čĆ╗#delicious  #healthyfood  #saglikliyasam  #healthylifestyle  #eatclean  #neyesek  #kahvaltidaneyesek  #pratikkahvalti  #kahvalti├Ânerisi  #breakfast  #oatmeal  #evyapimi  #homemade  #foodie  #foodporn  #instafood  #bugunneyesek  #diyetyemektarifleri  #yummy 
En h─▒zl─▒s─▒ndan bir ├Â─čle yeme─čiÔťî­čĆ╝
Hani hi├ž ├Âzenmeden sa├ž─▒n─▒z─▒ yapars─▒n─▒z da d├╝─č├╝n topuzu olur ya­čśů Bu da 5dk'da haz─▒rlad─▒─č─▒m de─čme restorant salatalar─▒na ta┼č ├ž─▒kartan salatam­čî┐
Bir kase roka ├╝st├╝ ya─čs─▒z sotelenmi┼č tavuk­čśő ├ťzerine zerde├žal, nar ek┼čisi ve ├ž├Ârek otu. Vallahi de mis­čśő Deneyin, pi┼čman olmayacaks─▒n─▒z­čśë
En h─▒zl─▒s─▒ndan bir ├Â─čle yeme─čiÔťî­čĆ╝ Hani hi├ž ├Âzenmeden sa├ž─▒n─▒z─▒ yapars─▒n─▒z da d├╝─č├╝n topuzu olur ya­čśů Bu da 5dk'da haz─▒rlad─▒─č─▒m de─čme restorant salatalar─▒na ta┼č ├ž─▒kartan salatam­čî┐ Bir kase roka ├╝st├╝ ya─čs─▒z sotelenmi┼č tavuk­čśő ├ťzerine zerde├žal, nar ek┼čisi ve ├ž├Ârek otu. Vallahi de mis­čśő Deneyin, pi┼čman olmayacaks─▒n─▒z­čśë
G├╝nde en az bir fincan­čśë
G├╝nde en az bir fincan­čśë
G├╝nayd─▒nnnnԜǴŞĆ
Biraz ge├ž kald─▒ fark─▒nday─▒m ama ge├ž olsun g├╝├ž olmas─▒n diyerek kahvalt─▒m─▒n ba┼č rol├╝n├╝ sizlere sunuyorum. Enn domatesli biberlisinden yumurta­čŹů­čąÜ­čî Menemen de denebilir san─▒r─▒m­čśç Yan─▒nda bolca domates&salatal─▒k­čŹů­čąĺ Hatta ben biraz ┼č─▒mar─▒kl─▒k yap─▒p ├╝zerine nar ek┼čisi de gezdirdim­čÖł mmmhhh­čśő Biraz da peynir, zeytinÔÖą´ŞĆ
G├╝nayd─▒nnnnԜǴŞĆ Biraz ge├ž kald─▒ fark─▒nday─▒m ama ge├ž olsun g├╝├ž olmas─▒n diyerek kahvalt─▒m─▒n ba┼č rol├╝n├╝ sizlere sunuyorum. Enn domatesli biberlisinden yumurta­čŹů­čąÜ­čî Menemen de denebilir san─▒r─▒m­čśç Yan─▒nda bolca domates&salatal─▒k­čŹů­čąĺ Hatta ben biraz ┼č─▒mar─▒kl─▒k yap─▒p ├╝zerine nar ek┼čisi de gezdirdim­čÖł mmmhhh­čśő Biraz da peynir, zeytinÔÖą´ŞĆ
Yaz g├╝zelleriyle devam­čśŹ
Semizotunun ister yeme─čini yap─▒n ister domatesli salatas─▒n─▒ ister yo─čurtlu mezesini.. her t├╝rl├╝ yaz sofralar─▒n─▒n en g├╝zeli­čî┐ Omega 3 deposu, d├╝┼č├╝k kalorili, kalp dostu ve daha neler nelerÔťî­čĆ╝ Bol bol t├╝ketiniz efendim­čśë 
Not: yo─čurtlu ise zerde├žal, toz k─▒rm─▒z─▒ biber ve ├ž├Ârek otu ile favorim­čśő
Yaz g├╝zelleriyle devam­čśŹ Semizotunun ister yeme─čini yap─▒n ister domatesli salatas─▒n─▒ ister yo─čurtlu mezesini.. her t├╝rl├╝ yaz sofralar─▒n─▒n en g├╝zeli­čî┐ Omega 3 deposu, d├╝┼č├╝k kalorili, kalp dostu ve daha neler nelerÔťî­čĆ╝ Bol bol t├╝ketiniz efendim­čśë Not: yo─čurtlu ise zerde├žal, toz k─▒rm─▒z─▒ biber ve ├ž├Ârek otu ile favorim­čśő
Selam!
Efsane lezzetli bir ak┼čam yeme─či tavsiyem var­čÖő­čĆ╗
Bir s├╝redir k─▒zartma yapmaktan vazge├žmi┼č bulunuyorum­čÜź ├ťstelik evde k─▒zartma canavar─▒ bir e┼č varken­čĄÁ­čĆ╗ ve yaz aylar─▒n─▒n k─▒zartmas─▒z ge├žmesini hayal bile edemeyen bir ben­čÖł
├ç├Âz├╝m basit, sa─čl─▒kl─▒ ve ├žoook lezzetli­čśő ─░ster ┼čak┼čuka gibi minik minik do─čray─▒n sebzelerinizi, harmanlay─▒p at─▒n f─▒r─▒na (ki ├Âyle de efsane oluyor­čśő) ister foto─čraflardaki gibi patatesleri kayrak diye tabir etti─čimiz ince halkalar halinde do─čray─▒p yat─▒r─▒n f─▒r─▒n tepsisine, yan─▒na at─▒n pazardan al─▒nan mis tarla biberlerini­čąö­čî ├ťzerlerine yumurta f─▒r├žas─▒ ile az─▒c─▒k zeytin ya─č─▒ gezdirin. K─▒zarana kadar kals─▒nlar­čśő ┼×ak┼čuka yapmad─▒ysam patl─▒canlar─▒ ince ince do─čray─▒p tost makinesinde k─▒zartmay─▒ seviyorum f─▒r─▒n yerine. Onun i├žin de bak─▒n─▒z foto 2­čŹć
Selam! Efsane lezzetli bir ak┼čam yeme─či tavsiyem var­čÖő­čĆ╗ Bir s├╝redir k─▒zartma yapmaktan vazge├žmi┼č bulunuyorum­čÜź ├ťstelik evde k─▒zartma canavar─▒ bir e┼č varken­čĄÁ­čĆ╗ ve yaz aylar─▒n─▒n k─▒zartmas─▒z ge├žmesini hayal bile edemeyen bir ben­čÖł ├ç├Âz├╝m basit, sa─čl─▒kl─▒ ve ├žoook lezzetli­čśő ─░ster ┼čak┼čuka gibi minik minik do─čray─▒n sebzelerinizi, harmanlay─▒p at─▒n f─▒r─▒na (ki ├Âyle de efsane oluyor­čśő) ister foto─čraflardaki gibi patatesleri kayrak diye tabir etti─čimiz ince halkalar halinde do─čray─▒p yat─▒r─▒n f─▒r─▒n tepsisine, yan─▒na at─▒n pazardan al─▒nan mis tarla biberlerini­čąö­čî ├ťzerlerine yumurta f─▒r├žas─▒ ile az─▒c─▒k zeytin ya─č─▒ gezdirin. K─▒zarana kadar kals─▒nlar­čśő ┼×ak┼čuka yapmad─▒ysam patl─▒canlar─▒ ince ince do─čray─▒p tost makinesinde k─▒zartmay─▒ seviyorum f─▒r─▒n yerine. Onun i├žin de bak─▒n─▒z foto 2­čŹć
Dukan Biras─▒­čŹ║
Sevgili @yesimdiyettee sayesinde tan─▒┼čt─▒─č─▒m sa─čl─▒kl─▒ m─▒ sa─čl─▒kl─▒ so─čuk i├žecek. Ye┼čil ├žay, maden suyu ve limon kar─▒┼č─▒m─▒­čśő Tarif i├žin @yesimdiyettee 'nin sayfas─▒na ya da doo─čru google'a­čĆâ­čĆ╗ÔÇŹÔÖÇ´ŞĆÔŁô
Dukan Biras─▒­čŹ║ Sevgili @yesimdiyettee sayesinde tan─▒┼čt─▒─č─▒m sa─čl─▒kl─▒ m─▒ sa─čl─▒kl─▒ so─čuk i├žecek. Ye┼čil ├žay, maden suyu ve limon kar─▒┼č─▒m─▒­čśő Tarif i├žin @yesimdiyettee 'nin sayfas─▒na ya da doo─čru google'a­čĆâ­čĆ╗ÔÇŹÔÖÇ´ŞĆÔŁô
├ľ─čle yeme─či zaman─▒─▒─▒─▒­čśő
D├╝n k─▒┼č i├žin ye┼čil dolmal─▒k biber haz─▒rlad─▒m. Bir k─▒sm─▒ buzlu─ča bir k─▒sm─▒ da balkona kurumayaԜǴŞĆ Kurumas─▒ i├žin dizdiklerimin ├╝st k─▒s─▒mlar─▒ artm─▒┼čt─▒, bug├╝ne ├Â─čle yeme─čim oldular­čśő ├çok benzer bir tarifi sevgili @fitmuhendisce 'de g├Ârm├╝┼čt├╝m. Bolca mevsim domates k├╝p k├╝p do─čran─▒r, pi┼čmek ├╝zere oca─ča al─▒n─▒r. Sular─▒n─▒ sal─▒p pi┼čmek ├╝zereyken biberler eklenir ve bir s├╝re daha pi┼čirilir­čĹę­čĆ╗ÔÇŹ­čŹ│ ─░┼čte bu kadaaaar­čśç Hi├ž ya─č yok. ─░stenilen baharatlar eklenebilir. Hatta biraz da sar─▒msak­čśë Mmmmhhh mis gibi yaz yeme─či vallahi­čśů Yan─▒na da bir iki damlac─▒k s─▒zma zeytinya─č─▒nda ├Âld├╝rd├╝─č├╝m havu├ž dilimleri ve bol sar─▒msakl─▒ yo─čurt­čąĽ Ben ├╝zerine birazc─▒k da zerde├žal ve da─č keki─či ekledimÔťî­čĆ╝ Pek de afiyet oldu do─črusu­čÖł
├ľ─čle yeme─či zaman─▒─▒─▒─▒­čśő D├╝n k─▒┼č i├žin ye┼čil dolmal─▒k biber haz─▒rlad─▒m. Bir k─▒sm─▒ buzlu─ča bir k─▒sm─▒ da balkona kurumayaԜǴŞĆ Kurumas─▒ i├žin dizdiklerimin ├╝st k─▒s─▒mlar─▒ artm─▒┼čt─▒, bug├╝ne ├Â─čle yeme─čim oldular­čśő ├çok benzer bir tarifi sevgili @fitmuhendisce 'de g├Ârm├╝┼čt├╝m. Bolca mevsim domates k├╝p k├╝p do─čran─▒r, pi┼čmek ├╝zere oca─ča al─▒n─▒r. Sular─▒n─▒ sal─▒p pi┼čmek ├╝zereyken biberler eklenir ve bir s├╝re daha pi┼čirilir­čĹę­čĆ╗ÔÇŹ­čŹ│ ─░┼čte bu kadaaaar­čśç Hi├ž ya─č yok. ─░stenilen baharatlar eklenebilir. Hatta biraz da sar─▒msak­čśë Mmmmhhh mis gibi yaz yeme─či vallahi­čśů Yan─▒na da bir iki damlac─▒k s─▒zma zeytinya─č─▒nda ├Âld├╝rd├╝─č├╝m havu├ž dilimleri ve bol sar─▒msakl─▒ yo─čurt­čąĽ Ben ├╝zerine birazc─▒k da zerde├žal ve da─č keki─či ekledimÔťî­čĆ╝ Pek de afiyet oldu do─črusu­čÖł
Bi ma┼čallah─▒ hem anne hem bebe─či i├žin alal─▒m Ôťî­čĆ╗´ŞĆ
Her hafta ├çat─▒r ├žat─▒r ya─člar─▒ yak─▒yor d├╝┼čmanlar─▒m─▒z─▒da ├žat─▒r ├žat─▒r ├žatlat─▒yoruz ­čśé
Emzirirken s├╝t├╝m olsun diye yedik├že yerseniz ki b├╝y├╝k ihtimalle yedi─činiz sa─čl─▒ks─▒z ┼čeyler y├╝z├╝nden bebe─činizin i├žti─či s├╝tt├╝nde kalitesi d├╝┼č├╝kt├╝r. Evet hem emzirirken diyet yapabilirsin bu bebe─čin i├žinde iyi olacakt─▒r. Diyet yap─▒nca s├╝t├╝n azalmaz aksine i├žeri─či zenginle┼čir ┼čimdi sen s├╝t├╝n olsun diye kek pata ├ž├Ârek b├Ârek mant─▒ bazlama hamur i┼člerini ve gereksiz fazlal─▒kta meyve yiyorsan bunlar sana kalitesiz s├╝t ­čŹ╝ ve kilo olarak d├Ânecek hele ki ilk do─čumunsa muhtemelen herkes ye sen emziriyorsun telkinlerinde bulunacak ┼×en'de tecr├╝besizlikten yada i┼čine geldi─či i├žin kan─▒p yiyip kilo alma ! uzman─▒ndan sana tavsiye yeme can─▒m yeme g├╝l├╝m ­čśä­čśäAnne olup formda olabilirsin ├žocu─čunun olmas─▒ sana kilolu olma hakk─▒n─▒ beraberinde getirmesin. Neden incecik gen├ž k─▒z gibi duran anne olabilecekken kilolu olas─▒n ki?  s├╝t├╝n i├žin bol s─▒v─▒ ve sa─čl─▒kl─▒ ayn─▒ zamanda yeteri kadar kalori Alman yetecektir.Ôťî­čĆ╗´ŞĆ
Do─čum sonras─▒ zaten ├žo─ču kad─▒nda depresif hal mevcuttur h─▒rs─▒n─▒ yemeklerden alma bahanen de s├╝t├╝n├╝ art─▒rmak olmas─▒n ­čśë

#diyetisyenmervegurbetaksoy #dietform #kayseri #diyetisyenkayseri #kayseridiyetisyen #kayserizay─▒flama #b├Âlgeselincelme #kiloverme #kavitasyonkayseri #diyetyemektarifleri #sa─čl─▒kl─▒ya┼ča  #emzirenannelerdezayiflar #lohusa
Bi ma┼čallah─▒ hem anne hem bebe─či i├žin alal─▒m Ôťî­čĆ╗´ŞĆ Her hafta ├çat─▒r ├žat─▒r ya─člar─▒ yak─▒yor d├╝┼čmanlar─▒m─▒z─▒da ├žat─▒r ├žat─▒r ├žatlat─▒yoruz ­čśé Emzirirken s├╝t├╝m olsun diye yedik├že yerseniz ki b├╝y├╝k ihtimalle yedi─činiz sa─čl─▒ks─▒z ┼čeyler y├╝z├╝nden bebe─činizin i├žti─či s├╝tt├╝nde kalitesi d├╝┼č├╝kt├╝r. Evet hem emzirirken diyet yapabilirsin bu bebe─čin i├žinde iyi olacakt─▒r. Diyet yap─▒nca s├╝t├╝n azalmaz aksine i├žeri─či zenginle┼čir ┼čimdi sen s├╝t├╝n olsun diye kek pata ├ž├Ârek b├Ârek mant─▒ bazlama hamur i┼člerini ve gereksiz fazlal─▒kta meyve yiyorsan bunlar sana kalitesiz s├╝t ­čŹ╝ ve kilo olarak d├Ânecek hele ki ilk do─čumunsa muhtemelen herkes ye sen emziriyorsun telkinlerinde bulunacak ┼×en'de tecr├╝besizlikten yada i┼čine geldi─či i├žin kan─▒p yiyip kilo alma ! uzman─▒ndan sana tavsiye yeme can─▒m yeme g├╝l├╝m ­čśä­čśäAnne olup formda olabilirsin ├žocu─čunun olmas─▒ sana kilolu olma hakk─▒n─▒ beraberinde getirmesin. Neden incecik gen├ž k─▒z gibi duran anne olabilecekken kilolu olas─▒n ki? s├╝t├╝n i├žin bol s─▒v─▒ ve sa─čl─▒kl─▒ ayn─▒ zamanda yeteri kadar kalori Alman yetecektir.Ôťî­čĆ╗´ŞĆ Do─čum sonras─▒ zaten ├žo─ču kad─▒nda depresif hal mevcuttur h─▒rs─▒n─▒ yemeklerden alma bahanen de s├╝t├╝n├╝ art─▒rmak olmas─▒n ­čśë #diyetisyenmervegurbetaksoy  #dietform  #kayseri  #diyetisyenkayseri  #kayseridiyetisyen  #kayserizay─▒flama  #b├Âlgeselincelme  #kiloverme  #kavitasyonkayseri  #diyetyemektarifleri  #sa─čl─▒kl─▒ya┼ča  #emzirenannelerdezayiflar  #lohusa 
Yeni bir haftadan herkese merhaba ­čĄŚ Pazartesileri ├žok severim ben ­čĄŚ Sanki t├╝m s─▒k─▒nt─▒lar ge├žmi┼čte kalm─▒┼č gibi yepyeni ba┼člang─▒├žlar bizleri bekliyor gibi gelir ÔŁĄ ─░┼čte tam da bu y├╝zden bug├╝n ─░ngilizce ├žal─▒┼čmaya ba┼člayaca─č─▒m ­čśŐAncak ├Âncelikle sa─čl─▒kl─▒ yemeklerimizi haz─▒rlamam─▒z laz─▒m ­čŹŤ Bug├╝n men├╝de nohut ve kabak var ­čśÄ O zaman hem afiyet olsun hem de Allah zihin a├ž─▒kl─▒─č─▒ versin ­čĄŚ #diyet #diyetyemektarifleri #diyetyeme─či #diyetyemek #diyetyap #diyetyapalim #diyetyapanlarburaya #diyetyapanlartakiple┼čsin #diyetyapanlartakiple┼čiyor #sagliklibedeneyolculuk #aslihanin_d├╝nyas─▒
Yeni bir haftadan herkese merhaba ­čĄŚ Pazartesileri ├žok severim ben ­čĄŚ Sanki t├╝m s─▒k─▒nt─▒lar ge├žmi┼čte kalm─▒┼č gibi yepyeni ba┼člang─▒├žlar bizleri bekliyor gibi gelir ÔŁĄ ─░┼čte tam da bu y├╝zden bug├╝n ─░ngilizce ├žal─▒┼čmaya ba┼člayaca─č─▒m ­čśŐAncak ├Âncelikle sa─čl─▒kl─▒ yemeklerimizi haz─▒rlamam─▒z laz─▒m ­čŹŤ Bug├╝n men├╝de nohut ve kabak var ­čśÄ O zaman hem afiyet olsun hem de Allah zihin a├ž─▒kl─▒─č─▒ versin ­čĄŚ #diyet  #diyetyemektarifleri  #diyetyeme─či  #diyetyemek  #diyetyap  #diyetyapalim  #diyetyapanlarburaya  #diyetyapanlartakiple┼čsin  #diyetyapanlartakiple┼čiyor  #sagliklibedeneyolculuk  #aslihanin_d├╝nyas─▒ 
├ľ─čle Yeme─čiŃÇőTavuk sote yan─▒nda bir dilim tam bu─čday ekme─či­čŹ┤

#diyet #diyetyolu #diyetyemektarifleri #diyethesaplaritakiplesiyor #diyetkardesligi
Merhaba ­čĄŚ ┼×eker orucunda 5.g├╝n ­čĄŚ 4 g├╝nd├╝r de g├╝nde 45 dakika y├╝r├╝y├╝┼č yap─▒yorum ­čĄŚ -Kabak dolmas─▒ (bulgur ile etsiz) -Yo─čurt (light de─čil) -Izgara tavuk ­čÉö
Haydi siz de ba┼člay─▒n de─či┼čim i├žin ­čÖä Ya─čl─▒ bir bedene sahip olmak zorunda de─čiliz ­čśŐ Her ┼čeyden ├Ânemlisi ise MUTLAKA bir beslenme uzman─▒na DANI┼×IN ­čĄô #diyet #diyetkardesli─či #diyetyap #diyetyemektarifleri #diyetyemek #diyetyapiyorum #sagliklibedeneyolculuk #sagliklibeslenme #saglikliyasam #zayiflama #zayifla #zayiflamagunlugu #zayiflamak #zay─▒flama├╝r├╝nleri #kabaksalatas─▒ #kabakyeme─či #kabakyemekleri #kabakyeme─čikepeklibulgurk─▒rm─▒z─▒bibervehavu├ž #kabakdolmas─▒ #kabakdolmasi #kabakdolmas─▒yapmay─▒sizden├Â─črenecekde─čiliz #kabakdolma #izgara #izgaracesitleri #izgaramzastrast #son18kilo #aslihanin_d├╝nyas─▒
Merhaba ­čĄŚ ┼×eker orucunda 5.g├╝n ­čĄŚ 4 g├╝nd├╝r de g├╝nde 45 dakika y├╝r├╝y├╝┼č yap─▒yorum ­čĄŚ -Kabak dolmas─▒ (bulgur ile etsiz) -Yo─čurt (light de─čil) -Izgara tavuk ­čÉö Haydi siz de ba┼člay─▒n de─či┼čim i├žin ­čÖä Ya─čl─▒ bir bedene sahip olmak zorunda de─čiliz ­čśŐ Her ┼čeyden ├Ânemlisi ise MUTLAKA bir beslenme uzman─▒na DANI┼×IN ­čĄô #diyet  #diyetkardesli─či  #diyetyap  #diyetyemektarifleri  #diyetyemek  #diyetyapiyorum  #sagliklibedeneyolculuk  #sagliklibeslenme  #saglikliyasam  #zayiflama  #zayifla  #zayiflamagunlugu  #zayiflamak  #zay─▒flama├╝r├╝nleri  #kabaksalatas─▒  #kabakyeme─či  #kabakyemekleri  #kabakyeme─čikepeklibulgurk─▒rm─▒z─▒bibervehavu├ž  #kabakdolmas─▒  #kabakdolmasi  #kabakdolmas─▒yapmay─▒sizden├Â─črenecekde─čiliz  #kabakdolma  #izgara  #izgaracesitleri  #izgaramzastrast  #son18kilo  #aslihanin_d├╝nyas─▒ 
Biz lezzetli ve doyurucu bir kahvalt─▒ ile g├╝ne merhaba diyoruz­č嬭čĆ╝ Sende bize kat─▒l­čĹÇ @fittimecomtr #diyetyemekleri #diyetyemek #diyetyemekankara #ankaradiyet #diyetisyen #ankarasagl─▒kl─▒beslenme #beslenme├Ânerileri #fitness #dietfood #dieting #diyetzaman─▒ #dytsanemturkmaya #eveyemek #yemekservisi #diyetyemektarifleri #diyetyemekservisi
Cuma ak┼čam─▒ mangalda yapamasak da f─▒r─▒nda levrek pi┼čirme g├╝n├╝ ilan edilmi┼čtir.┬á Bal─▒─č─▒n yan─▒nda bizim yapt─▒─č─▒m─▒z gibi so─čan ve kal─▒n halka dilim patates kullanmak yeme─čin hem tad─▒n─▒ hem de doyuruculugunu ciddi g├╝zelle┼čtiriyor. Biraz limon , sar─▒msak , defne yapra─č─▒ ve mantar─▒n da e┼člik etti─či sa─čl─▒kl─▒ ve lezzetli yeme─čin yan─▒nda bol ye┼čil salata ideal! #delicia #delicious #instafoodie #instagood #izmir #healthyeating #healthyfood #seabass #levrek #yummytime #yummy #foodpic #foodpics #foodie #tgif #food #foodgasm #foodporn #foodpost #diyetyemektarifleri #fit #dinner #blog #gourmet #potato #onion
Cuma ak┼čam─▒ mangalda yapamasak da f─▒r─▒nda levrek pi┼čirme g├╝n├╝ ilan edilmi┼čtir.┬á Bal─▒─č─▒n yan─▒nda bizim yapt─▒─č─▒m─▒z gibi so─čan ve kal─▒n halka dilim patates kullanmak yeme─čin hem tad─▒n─▒ hem de doyuruculugunu ciddi g├╝zelle┼čtiriyor. Biraz limon , sar─▒msak , defne yapra─č─▒ ve mantar─▒n da e┼člik etti─či sa─čl─▒kl─▒ ve lezzetli yeme─čin yan─▒nda bol ye┼čil salata ideal! #delicia  #delicious  #instafoodie  #instagood  #izmir  #healthyeating  #healthyfood  #seabass  #levrek  #yummytime  #yummy  #foodpic  #foodpics  #foodie  #tgif  #food  #foodgasm  #foodporn  #foodpost  #diyetyemektarifleri  #fit  #dinner  #blog  #gourmet  #potato  #onion 
D vitamini eksikli─činin depresyona neden oldu─čunu biliyor muydunuz?­čÖä G├╝nde en az 10 dakika koruma fakt├Ârl├╝ g├╝ne┼č kreminiz ile ├ž─▒kt─▒─č─▒n─▒z g├╝ne┼čten de g├╝nl├╝k D vitamini ihtiyac─▒n─▒z─▒ kar┼č─▒layabilirsiniz. ÔśëFakat gelin g├Âr├╝n ki bizim gibi ├žal─▒┼čan ve sene de sadece 1 hafta tatil yapan bireyler i├žin o s├╝re yeterli de─čil. Bunun i├žin hafta da 1 kez besinler ile birlikte takviye almam─▒z gerekiyor. Ton bal─▒─č─▒ D vitamini alabilece─čimiz en pratik besinlerin ba┼č─▒nda geliyor.­čÉ│ Bence salataya da ├žok yak─▒┼č─▒yor­čĄôTon bal─▒─č─▒ roka ile birlikte al─▒nd─▒─č─▒nda hem ba─č─▒┼č─▒kl─▒k sistemini g├╝├žlendiriyor hem de cildi g├╝zelle┼čtiriyor­čĄŚ ­čö║Benim kavanoz salatam­čŹâ g├Âbek marul, salatal─▒k, domates, roka, k─▒rm─▒z─▒ biber ve ton bal─▒─č─▒ndan olu┼čuyor.
­čö║Sosu; bir yemek ka┼č─▒─č─▒ saf zeytinya─č, yar─▒m limon, karabiber, az nane az zerde├žal.
1 adette kepekli wasa ­čÉĘ Afiyet olsun ­čÉú
#zeynointhekitchen #diyet #diyetyemektarifleri #healthyfood #lunch #lunchbox #homemade
D vitamini eksikli─činin depresyona neden oldu─čunu biliyor muydunuz?­čÖä G├╝nde en az 10 dakika koruma fakt├Ârl├╝ g├╝ne┼č kreminiz ile ├ž─▒kt─▒─č─▒n─▒z g├╝ne┼čten de g├╝nl├╝k D vitamini ihtiyac─▒n─▒z─▒ kar┼č─▒layabilirsiniz. ÔśëFakat gelin g├Âr├╝n ki bizim gibi ├žal─▒┼čan ve sene de sadece 1 hafta tatil yapan bireyler i├žin o s├╝re yeterli de─čil. Bunun i├žin hafta da 1 kez besinler ile birlikte takviye almam─▒z gerekiyor. Ton bal─▒─č─▒ D vitamini alabilece─čimiz en pratik besinlerin ba┼č─▒nda geliyor.­čÉ│ Bence salataya da ├žok yak─▒┼č─▒yor­čĄôTon bal─▒─č─▒ roka ile birlikte al─▒nd─▒─č─▒nda hem ba─č─▒┼č─▒kl─▒k sistemini g├╝├žlendiriyor hem de cildi g├╝zelle┼čtiriyor­čĄŚ ­čö║Benim kavanoz salatam­čŹâ g├Âbek marul, salatal─▒k, domates, roka, k─▒rm─▒z─▒ biber ve ton bal─▒─č─▒ndan olu┼čuyor. ­čö║Sosu; bir yemek ka┼č─▒─č─▒ saf zeytinya─č, yar─▒m limon, karabiber, az nane az zerde├žal. 1 adette kepekli wasa ­čÉĘ Afiyet olsun ­čÉú #zeynointhekitchen  #diyet  #diyetyemektarifleri  #healthyfood  #lunch  #lunchbox  #homemade 
Bug├╝n serin serin mantar salatas─▒ m─▒ yapsak ­čĹŹ­čĆ╗­čśś­čŹä
YO─×URTLU MANTAR SALATASI

Malzemeler: 1 paket mantar (400 gram)

1 su barda─č─▒ yo─čurt

2 di┼č sar─▒msak

1 ├žay barda─č─▒ arpa ┼čehriye

2 ├žorba ka┼č─▒─č─▒ mayonez

├ťzeri i├žin:1 ├žorba ka┼č─▒─č─▒ tereya─č─▒ +1 ├žorba ka┼č─▒─č─▒ s─▒v─▒ya─č

1 tatl─▒ ka┼č─▒─č─▒ nane

1 tatl─▒ ka┼č─▒─č─▒ pulbiber

Yap─▒l─▒┼č─▒:Mantarlar─▒ temizleyip do─čray─▒n.Az s─▒v─▒ya─čda suyunu ├žektirerek pi┼čirin.┼×ehriyeleri ha┼člay─▒p suyunu s├╝z├╝n.Mantar ve ┼čehriye ─▒l─▒y─▒nca geni┼č bir kaba al─▒p i├žine yo─čurt,mayonez ve rendelenmi┼č sar─▒msa─č─▒ ekleyip kar─▒┼čt─▒r─▒n.Ya─č─▒ k─▒zd─▒r─▒p nane ve biberi ekleyin.Bu sosu salatan─▒n ├╝zerine gezdirip servis yap─▒n.Afiyet olsunÔÇŽ#tarifyolla #mantar #mantarsalatas─▒ #yo─čurtlumantarsalatas─▒ #salatalar #salata #salatatarifleri #diyet #diyetyemekleri #diyetyemektarifleri #diyetteyim #diyetteyiz #yazyemekleri #hafifyemekler #diyetsalata #salat #dietfood #diet #diyettarifler #turkishfood
Bug├╝n serin serin mantar salatas─▒ m─▒ yapsak ­čĹŹ­čĆ╗­čśś­čŹä YO─×URTLU MANTAR SALATASI Malzemeler: 1 paket mantar (400 gram) 1 su barda─č─▒ yo─čurt 2 di┼č sar─▒msak 1 ├žay barda─č─▒ arpa ┼čehriye 2 ├žorba ka┼č─▒─č─▒ mayonez ├ťzeri i├žin:1 ├žorba ka┼č─▒─č─▒ tereya─č─▒ +1 ├žorba ka┼č─▒─č─▒ s─▒v─▒ya─č 1 tatl─▒ ka┼č─▒─č─▒ nane 1 tatl─▒ ka┼č─▒─č─▒ pulbiber Yap─▒l─▒┼č─▒:Mantarlar─▒ temizleyip do─čray─▒n.Az s─▒v─▒ya─čda suyunu ├žektirerek pi┼čirin.┼×ehriyeleri ha┼člay─▒p suyunu s├╝z├╝n.Mantar ve ┼čehriye ─▒l─▒y─▒nca geni┼č bir kaba al─▒p i├žine yo─čurt,mayonez ve rendelenmi┼č sar─▒msa─č─▒ ekleyip kar─▒┼čt─▒r─▒n.Ya─č─▒ k─▒zd─▒r─▒p nane ve biberi ekleyin.Bu sosu salatan─▒n ├╝zerine gezdirip servis yap─▒n.Afiyet olsunÔÇŽ#tarifyolla  #mantar  #mantarsalatas─▒  #yo─čurtlumantarsalatas─▒  #salatalar  #salata  #salatatarifleri  #diyet  #diyetyemekleri  #diyetyemektarifleri  #diyetteyim  #diyetteyiz  #yazyemekleri  #hafifyemekler  #diyetsalata  #salat  #dietfood  #diet  #diyettarifler  #turkishfood 
Bu sabah g├╝zel olan tek ┼čey bu. Gerisi ayn─▒... Ayn─▒ ├žirkin insanlar, ayn─▒ beton yap─▒lar, ayn─▒ oksijensiz hava, ayn─▒ g├╝vensiz ve mutsuz ortam,  ayn─▒ h─▒zda y├╝r├╝yen kalabal─▒k, ayn─▒ bal─▒k istifi #metrob├╝s , ayn─▒ ├ž├Âpl├╝k #istanbul ... ­čŹ│­čŹ│­čŹ│
-Her g├╝n ha┼članm─▒┼č yumurta mi yiceeem?
-Hay─▒r, meselaaaa ├ž─▒lb─▒r yapabilirsiniz.
-Offf ├žok s─▒k─▒c─▒...
-O zaman paz─▒ yata─č─▒nda yo─čurtlu po┼če yumurta yap─▒n. Biberiyeli ve k─▒rm─▒z─▒ biberli... Nas─▒l?
-Harikaaaaaaaaaaa...
­čś▒­čś▒­čś▒
Bilmiyor ki ├ž─▒lb─▒r dedi─čim zaten yo─čurtlu po┼če yumurta... Sonra da gelmi┼č bana hava at─▒yor. "Diyetten s─▒k─▒ld─▒m!" diye... Bence sen kendinden s─▒k─▒lm─▒┼čs─▒n. Cahilli─činden, g├Ârg├╝s├╝zl├╝─č├╝nden, kendini be─čenmi┼čli─činden... Kendinden s─▒k─▒lm─▒┼čs─▒n da fark─▒nda de─čilsin be tatl─▒┼č. Bak yine  #mutluluktangeberendiyetisyen
 ├žizgimden kayd─▒rd─▒n─▒z beni haaa... ­čśÇ­čśÇ­čśÇ­čśÇ #nolfilter #g├╝zellik #kahvalti #hayat #e─čitim #g├Ârg├╝s├╝z #tarifler #yumurta #po┼čeyumurta #diyetisyen #diyetisyenim #diyet #diyetyemektarifleri #diyetyemek #benseninbildigindiyetisyenlerdendegilim
Bu sabah g├╝zel olan tek ┼čey bu. Gerisi ayn─▒... Ayn─▒ ├žirkin insanlar, ayn─▒ beton yap─▒lar, ayn─▒ oksijensiz hava, ayn─▒ g├╝vensiz ve mutsuz ortam, ayn─▒ h─▒zda y├╝r├╝yen kalabal─▒k, ayn─▒ bal─▒k istifi #metrob├╝s  , ayn─▒ ├ž├Âpl├╝k #istanbul  ... ­čŹ│­čŹ│­čŹ│ -Her g├╝n ha┼članm─▒┼č yumurta mi yiceeem? -Hay─▒r, meselaaaa ├ž─▒lb─▒r yapabilirsiniz. -Offf ├žok s─▒k─▒c─▒... -O zaman paz─▒ yata─č─▒nda yo─čurtlu po┼če yumurta yap─▒n. Biberiyeli ve k─▒rm─▒z─▒ biberli... Nas─▒l? -Harikaaaaaaaaaaa... ­čś▒­čś▒­čś▒ Bilmiyor ki ├ž─▒lb─▒r dedi─čim zaten yo─čurtlu po┼če yumurta... Sonra da gelmi┼č bana hava at─▒yor. "Diyetten s─▒k─▒ld─▒m!" diye... Bence sen kendinden s─▒k─▒lm─▒┼čs─▒n. Cahilli─činden, g├Ârg├╝s├╝zl├╝─č├╝nden, kendini be─čenmi┼čli─činden... Kendinden s─▒k─▒lm─▒┼čs─▒n da fark─▒nda de─čilsin be tatl─▒┼č. Bak yine #mutluluktangeberendiyetisyen  ├žizgimden kayd─▒rd─▒n─▒z beni haaa... ­čśÇ­čśÇ­čśÇ­čśÇ #nolfilter  #g├╝zellik  #kahvalti  #hayat  #e─čitim  #g├Ârg├╝s├╝z  #tarifler  #yumurta  #po┼čeyumurta  #diyetisyen  #diyetisyenim  #diyet  #diyetyemektarifleri  #diyetyemek  #benseninbildigindiyetisyenlerdendegilim 
Fit Time ekibi olarak do─čay─▒ ├Ânemsiyoruz. Siz de g├Ârevli arkada┼č─▒m─▒za kullan─▒lm─▒┼č paketlerinizi teslim ederseniz birlikte geri d├Ân├╝┼č├╝me yarar sa─člam─▒┼č oluruz. #diyetzamani #spordabeslenme #sportsnutrition #dietitianapproved #dietmotivation #diyetteyim #diyetyemek #diyetzamani #diyetyeme─či #ankara #ankaradiyet #ankarayemek #ankarazay─▒flama #ankaradiyetisyen #diyetyemekleri #diyetyemektarifleri #diyetyemekankara #diyetyemekler #diyetyemekkap─▒nda #diyetyemekservisi #sa─čl─▒kl─▒beslenme #sagliklibedeneyolculuk #dytsanemturkmaya #fittimecomtr #haftasonu #breakfast #breakfastofchampions #benimkahvaltim
Fit Time ekibi olarak do─čay─▒ ├Ânemsiyoruz. Siz de g├Ârevli arkada┼č─▒m─▒za kullan─▒lm─▒┼č paketlerinizi teslim ederseniz birlikte geri d├Ân├╝┼č├╝me yarar sa─člam─▒┼č oluruz. #diyetzamani  #spordabeslenme  #sportsnutrition  #dietitianapproved  #dietmotivation  #diyetteyim  #diyetyemek  #diyetzamani  #diyetyeme─či  #ankara  #ankaradiyet  #ankarayemek  #ankarazay─▒flama  #ankaradiyetisyen  #diyetyemekleri  #diyetyemektarifleri  #diyetyemekankara  #diyetyemekler  #diyetyemekkap─▒nda  #diyetyemekservisi  #sa─čl─▒kl─▒beslenme  #sagliklibedeneyolculuk  #dytsanemturkmaya  #fittimecomtr  #haftasonu  #breakfast  #breakfastofchampions  #benimkahvaltim 
Kalan ha┼člama tavuklarimi bir domates rendesi ve biberle azcik pi┼čirerek yedim ­čśŐ
Kalan ha┼člama tavuklarimi bir domates rendesi ve biberle azcik pi┼čirerek yedim ­čśŐ
Son staj g├╝n├╝mdeki s├╝rprizli elma toplar─▒na ho┼čgeldiniz ­čĹĘÔÇŹ­čŹ│. S├╝rprizi hemen a├ž─▒kl─▒yorum bu arkada┼člar─▒n i├žinde bitter ├žikolata ile kaplanm─▒┼č f─▒nd─▒klar var­čĄŚ. Hemen malzemelerimizi vereyim.­čĄŚ
­čö┤3-4 adet elma
­čö┤2 yemek ka┼č─▒─č─▒ pekmez yada bal
­čö┤10 adet ceviz
­čö┤ 2 tatl─▒ ka┼č─▒─č─▒ tar├ž─▒n
­čö┤ 4 yemek ka┼č─▒─č─▒ yulaf ezmesi
­čö┤Her elmal─▒ top i├žin 1 adet f─▒nd─▒k (yakla┼č─▒k 20 adet ├ž─▒k─▒yor. Yani 20 adet f─▒nd─▒k) 
Peki nas─▒l yap─▒yoruz bu s├╝rprizli elma toplar─▒n─▒ hemen anlat─▒yorum.
­čöÁElmalar─▒m─▒z─▒ rendeleyip bir teflon tavaya al─▒yoruz bal ya da pekmezimizi ve di─čer malzemelerimizi ekleyip elmalar─▒m─▒z─▒n rengi birazc─▒k d├Ân├╝nceye kadar soteliyoruz. Ve so─čumaya b─▒rak─▒yoruz. ( ben yulaf ezmesi ve cevizleri birazc─▒k mutfak robotunda ├žekip ekledim.)
­čöÁDaha sonra F─▒nd─▒klar─▒m─▒z i├žin y├╝zde 70 kakao oranl─▒ 1 paket bitter ├žikolata kulland─▒m. Benmaride erittigim bitter ├žikolatam─▒n i├žine f─▒nd─▒klar─▒ att─▒m ve her tarafi ├žikolata olana kadar kar─▒┼čt─▒rd─▒m.­čĹĘÔÇŹ­čŹ│­čĹĘÔÇŹ­čŹ│­čĹĘÔÇŹ­čŹ│­čĹĘÔÇŹ­čŹ│ buras─▒ ├žok e─členceli idi ­čśé.Daha sonra buzdolab─▒na al─▒p biraz donmas─▒n─▒ bekledim. ­čöÁVe evet sona geldik elmal─▒ harcimizi al─▒p elimizde biraz a├ž─▒p i├žine 1 adet bitter ├žikolatal─▒ f─▒nd─▒k koyup top ┼čekline getirip hooop g├Ânder hindistan cevizi tozuna ­čĄŚ­čĄŚ­čĄŚ. ─░┼čte hepsi bu kadar bu s├╝rprizli arkada┼člar─▒ mutlaka deneyin tad─▒ enfes do─črusu. ­čĹĘÔÇŹ­čŹ│
#diyetisyen #stajyerdiyetisyen #healthyfood #fitfood #saglikliyasam #foodphotography #diyetyemektarifleri #istanbul #alanya #iskenderun #adana #ramazanbayram─▒ #theyetmutfak #followme #fitappleball #fittatl─▒
Son staj g├╝n├╝mdeki s├╝rprizli elma toplar─▒na ho┼čgeldiniz ­čĹĘÔÇŹ­čŹ│. S├╝rprizi hemen a├ž─▒kl─▒yorum bu arkada┼člar─▒n i├žinde bitter ├žikolata ile kaplanm─▒┼č f─▒nd─▒klar var­čĄŚ. Hemen malzemelerimizi vereyim.­čĄŚ ­čö┤3-4 adet elma ­čö┤2 yemek ka┼č─▒─č─▒ pekmez yada bal ­čö┤10 adet ceviz ­čö┤ 2 tatl─▒ ka┼č─▒─č─▒ tar├ž─▒n ­čö┤ 4 yemek ka┼č─▒─č─▒ yulaf ezmesi ­čö┤Her elmal─▒ top i├žin 1 adet f─▒nd─▒k (yakla┼č─▒k 20 adet ├ž─▒k─▒yor. Yani 20 adet f─▒nd─▒k) Peki nas─▒l yap─▒yoruz bu s├╝rprizli elma toplar─▒n─▒ hemen anlat─▒yorum. ­čöÁElmalar─▒m─▒z─▒ rendeleyip bir teflon tavaya al─▒yoruz bal ya da pekmezimizi ve di─čer malzemelerimizi ekleyip elmalar─▒m─▒z─▒n rengi birazc─▒k d├Ân├╝nceye kadar soteliyoruz. Ve so─čumaya b─▒rak─▒yoruz. ( ben yulaf ezmesi ve cevizleri birazc─▒k mutfak robotunda ├žekip ekledim.) ­čöÁDaha sonra F─▒nd─▒klar─▒m─▒z i├žin y├╝zde 70 kakao oranl─▒ 1 paket bitter ├žikolata kulland─▒m. Benmaride erittigim bitter ├žikolatam─▒n i├žine f─▒nd─▒klar─▒ att─▒m ve her tarafi ├žikolata olana kadar kar─▒┼čt─▒rd─▒m.­čĹĘÔÇŹ­čŹ│­čĹĘÔÇŹ­čŹ│­čĹĘÔÇŹ­čŹ│­čĹĘÔÇŹ­čŹ│ buras─▒ ├žok e─členceli idi ­čśé.Daha sonra buzdolab─▒na al─▒p biraz donmas─▒n─▒ bekledim. ­čöÁVe evet sona geldik elmal─▒ harcimizi al─▒p elimizde biraz a├ž─▒p i├žine 1 adet bitter ├žikolatal─▒ f─▒nd─▒k koyup top ┼čekline getirip hooop g├Ânder hindistan cevizi tozuna ­čĄŚ­čĄŚ­čĄŚ. ─░┼čte hepsi bu kadar bu s├╝rprizli arkada┼člar─▒ mutlaka deneyin tad─▒ enfes do─črusu. ­čĹĘÔÇŹ­čŹ│ #diyetisyen  #stajyerdiyetisyen  #healthyfood  #fitfood  #saglikliyasam  #foodphotography  #diyetyemektarifleri  #istanbul  #alanya  #iskenderun  #adana  #ramazanbayram─▒  #theyetmutfak  #followme  #fitappleball  #fittatl─▒ 
Evet arkadaslar yemekleri yagsiz yaparak 17 kg verdim bugunden itibaren tarifleri paylasiyorum bugun cok az yagli patlican musakka yaptim tarifi *4 adet orta boy patlican * 300 gram kiyma
* 1 orta boy sogan
* Uc adet orta boy domates
* Iki adet yesil biber * az tuz ve karabiber * Bir kasik domates salcasi

arkadaslar patlicanlari gorselde paylastigim gibi suda hasladim sonra sudan aldim beklettim diger tavada sogan kiyma ve biberi kavurdm biraz su ekledm kiyma kendi yagini veriyor zaten uzerine domatesi karabiber tuz ve salcayi ekledim 
Daha sonra patlicanlari ayri bir tencereye dizdim uzerine kiymali harci onun da uzerine bir sira daha patlican dizdim tam yiyecekler seviyesinde sicak su koydum ve pisirdim. Tarifimiz basarili! Tad olarak hicbir farki yok afiyet olsunn:)) # musakka #diyetyemektarifleri #fildiyeti #aksamyemegi #yagsizmusakka #yagsizyemekler #spor #diyet #diyetteyim #diyetteyiz #diyethesaplaritakiplesiyor  #motivasyon #diyetkardesligi #zayiflama #zayiflamagunlugu #detox #diyetgunlugu #zayiflamakisteyenleretavsiyeler #yemek
Evet arkadaslar yemekleri yagsiz yaparak 17 kg verdim bugunden itibaren tarifleri paylasiyorum bugun cok az yagli patlican musakka yaptim tarifi *4 adet orta boy patlican * 300 gram kiyma * 1 orta boy sogan * Uc adet orta boy domates * Iki adet yesil biber * az tuz ve karabiber * Bir kasik domates salcasi arkadaslar patlicanlari gorselde paylastigim gibi suda hasladim sonra sudan aldim beklettim diger tavada sogan kiyma ve biberi kavurdm biraz su ekledm kiyma kendi yagini veriyor zaten uzerine domatesi karabiber tuz ve salcayi ekledim Daha sonra patlicanlari ayri bir tencereye dizdim uzerine kiymali harci onun da uzerine bir sira daha patlican dizdim tam yiyecekler seviyesinde sicak su koydum ve pisirdim. Tarifimiz basarili! Tad olarak hicbir farki yok afiyet olsunn:)) # musakka #diyetyemektarifleri  #fildiyeti  #aksamyemegi  #yagsizmusakka  #yagsizyemekler  #spor  #diyet  #diyetteyim  #diyetteyiz  #diyethesaplaritakiplesiyor  #motivasyon  #diyetkardesligi  #zayiflama  #zayiflamagunlugu  #detox  #diyetgunlugu  #zayiflamakisteyenleretavsiyeler  #yemek 
├ťz├╝lerek belirtiyorumki┬á verdigim kilolari geri almis bulunmaktayim ­čśč Bug├╝n herseye s─▒f─▒rdan ba┼čl─▒yorum. Zafer benim olacak inaniyorumÔťî­čśŐ #zayiflama #zayiflamakistiyorum #fit #beslenmevediyetetik #sagliklibeslenme #kilovermek #kilovermekistiyorum #diyet #diyettekilertakiple┼čiyor #diyetteyim #diyetyemek #diyetyemekler #diyetyemektarifleri #diyetmenuleri #diyetonerileri #diyetyapanlar #diyetarkadasligi #diyetarkadasim┬á #diyetekibi #rejim #perhiz #yemek #diyetyapanlar #instadiyet
├ťz├╝lerek belirtiyorumki┬á verdigim kilolari geri almis bulunmaktayim ­čśč Bug├╝n herseye s─▒f─▒rdan ba┼čl─▒yorum. Zafer benim olacak inaniyorumÔťî­čśŐ #zayiflama  #zayiflamakistiyorum  #fit  #beslenmevediyetetik  #sagliklibeslenme  #kilovermek  #kilovermekistiyorum  #diyet  #diyettekilertakiple┼čiyor  #diyetteyim  #diyetyemek  #diyetyemekler  #diyetyemektarifleri  #diyetmenuleri  #diyetonerileri  #diyetyapanlar  #diyetarkadasligi  #diyetarkadasim ┬á #diyetekibi  #rejim  #perhiz  #yemek  #diyetyapanlar  #instadiyet 
Merhabalar­čĄŚ­čĄŚ­čĄŚ. Bug├╝n kurucu ve y├Ânetici diyetisyenimiz say─▒n @diyetisyenpinaryetimoglu un do─čum g├╝n├╝ i├žin ad─▒n─▒ fit mozaik koydu─čumuz pastay─▒ yapt─▒m. Ve bu ├Âzel g├╝n i├žin tarifini sizlerle payla┼čmak istedim ­čĄŚ­čĄŚ Olduk├ža basit bir pasta olmas─▒na ra─čmen tad─▒ ger├žekten muhte┼čem oldu.  Deneyin pi┼čman olmayacaks─▒n─▒z ­čśé
Malzemelerimiz:
­čöŞ´ŞĆ3 yk yulaf ezmesi
­čöŞ´ŞĆ10 adet hurma
­čöŞ´ŞĆ1 orta boy muz
­čöŞ´ŞĆ6 adet ceviz ­čöŞ´ŞĆ10 adet f─▒nd─▒k ­čöŞ´ŞĆÔŁŚ Pastam─▒z─▒n ├╝st├╝ i├žin 8 kare bitter ├žikolata ve hindistan cevizi tozu 
Yap─▒l─▒┼č─▒na gelicek olursak­čĺ¬
­čö╣´ŞĆ3 yk yulaf ezmesini mutfak robotumuza koyup iri kalmas─▒ i├žin ├žok az ├žekiyoruz ­čö╣´ŞĆDaha sonra ├žekirdeklerini ├ž─▒kartt─▒─č─▒m─▒z hurmalar─▒m─▒z─▒ ve muzumuzu mutfak robotuna ekleyip ├žekiyoruz. ­čö╣´ŞĆBen cevizleri ve f─▒nd─▒klar─▒ en son robotumuza ekledim iri kalmas─▒ i├žinde 1 2 sn robotta ├žektim.
­čö╣´ŞĆVe evet pastam─▒z─▒n alt katman─▒ bu kadar bir d├╝z taba─ča ka┼č─▒k yard─▒m─▒ ile yay─▒p pastam─▒z─▒n ├╝st├╝ i├žin benmaride eritti─čimiz ├žikolatay─▒ bir ka┼č─▒k yard─▒m─▒yla iyice yay─▒yoruz. ­čö╣´ŞĆSon olarak histandancevizi tozumuzu istedi─činiz ┼čekilde ekleyip buzlu─ča koyuyoruz. ÔťöÔťöÔťö30 dk i├žinde yemeye haz─▒r olucaktir ­čśé­čśé­čśé. Biz bu pastay─▒ 6 ki┼čilik b├Âlm├╝┼čt├╝k. Sizde en az 2 ki┼či payla┼č─▒n ­čĄŚ 
#diyetisyen #stajyerdiyetisyen #nosugar #fitpasta #diyetyemektarifleri #sekersizpasta #instafood #iskenderun #d├Ârtyol  #payas #food  #foodporn #theyetmutfak
Merhabalar­čĄŚ­čĄŚ­čĄŚ. Bug├╝n kurucu ve y├Ânetici diyetisyenimiz say─▒n @diyetisyenpinaryetimoglu un do─čum g├╝n├╝ i├žin ad─▒n─▒ fit mozaik koydu─čumuz pastay─▒ yapt─▒m. Ve bu ├Âzel g├╝n i├žin tarifini sizlerle payla┼čmak istedim ­čĄŚ­čĄŚ Olduk├ža basit bir pasta olmas─▒na ra─čmen tad─▒ ger├žekten muhte┼čem oldu. Deneyin pi┼čman olmayacaks─▒n─▒z ­čśé Malzemelerimiz: ­čöŞ´ŞĆ3 yk yulaf ezmesi ­čöŞ´ŞĆ10 adet hurma ­čöŞ´ŞĆ1 orta boy muz ­čöŞ´ŞĆ6 adet ceviz ­čöŞ´ŞĆ10 adet f─▒nd─▒k ­čöŞ´ŞĆÔŁŚ Pastam─▒z─▒n ├╝st├╝ i├žin 8 kare bitter ├žikolata ve hindistan cevizi tozu Yap─▒l─▒┼č─▒na gelicek olursak­čĺ¬ ­čö╣´ŞĆ3 yk yulaf ezmesini mutfak robotumuza koyup iri kalmas─▒ i├žin ├žok az ├žekiyoruz ­čö╣´ŞĆDaha sonra ├žekirdeklerini ├ž─▒kartt─▒─č─▒m─▒z hurmalar─▒m─▒z─▒ ve muzumuzu mutfak robotuna ekleyip ├žekiyoruz. ­čö╣´ŞĆBen cevizleri ve f─▒nd─▒klar─▒ en son robotumuza ekledim iri kalmas─▒ i├žinde 1 2 sn robotta ├žektim. ­čö╣´ŞĆVe evet pastam─▒z─▒n alt katman─▒ bu kadar bir d├╝z taba─ča ka┼č─▒k yard─▒m─▒ ile yay─▒p pastam─▒z─▒n ├╝st├╝ i├žin benmaride eritti─čimiz ├žikolatay─▒ bir ka┼č─▒k yard─▒m─▒yla iyice yay─▒yoruz. ­čö╣´ŞĆSon olarak histandancevizi tozumuzu istedi─činiz ┼čekilde ekleyip buzlu─ča koyuyoruz. ÔťöÔťöÔťö30 dk i├žinde yemeye haz─▒r olucaktir ­čśé­čśé­čśé. Biz bu pastay─▒ 6 ki┼čilik b├Âlm├╝┼čt├╝k. Sizde en az 2 ki┼či payla┼č─▒n ­čĄŚ #diyetisyen  #stajyerdiyetisyen  #nosugar  #fitpasta  #diyetyemektarifleri  #sekersizpasta  #instafood  #iskenderun  #d├Ârtyol  #payas  #food  #foodporn  #theyetmutfak 
360 kcal­čĺ¬─░ftar­čĹł
Yeme─čim 1 porsiyon kadar ci─čer 150 kcal Ôťö
├çorbay─▒ bitiremedim ci─čerde kald─▒ biraz.+1 dilim ekmek yedim.Bug├╝n ilk kez demir ihtiyac─▒m─▒ tam olarak kars─▒lad─▒ yediklerim umar─▒m sizde kontrol ediyorsunuzdur yedi─činiz besinleriÔŁĽÔŁĽÔŁŚ
#oru├ž#iftarmen├╝s├╝ #oruclarimizikabuletsin #diyet #diyetyemektarifleri #diyetyemegi #zayiflamak #zay─▒fla#zay─▒folacag─▒n─▒zg├╝nlerihayaledin­čĹŹisteyin­čĹŹba┼čaracaks─▒n─▒z
360 kcal­čĺ¬─░ftar­čĹł Yeme─čim 1 porsiyon kadar ci─čer 150 kcal Ôťö ├çorbay─▒ bitiremedim ci─čerde kald─▒ biraz.+1 dilim ekmek yedim.Bug├╝n ilk kez demir ihtiyac─▒m─▒ tam olarak kars─▒lad─▒ yediklerim umar─▒m sizde kontrol ediyorsunuzdur yedi─činiz besinleriÔŁĽÔŁĽÔŁŚ #oru├ž #iftarmen├╝s├╝  #oruclarimizikabuletsin  #diyet  #diyetyemektarifleri  #diyetyemegi  #zayiflamak  #zay─▒fla #zay─▒folacag─▒n─▒zg├╝nlerihayaledin ­čĹŹisteyin­čĹŹba┼čaracaks─▒n─▒z
400 kcal­čĺ¬Sahur­čĹł
#sahuryeme─či #sahur #oru├ž #kendineinan #diyet #diyetyemektarifleri #zay─▒flamak #zay─▒flama #zay─▒folacag─▒n─▒zg├╝nlerihayaledin­čĹŹisteyin­čĹŹba┼čaracaks─▒n─▒z
Diyetisyenimiz diyor ki ­čĄŚÔś║´ŞĆ Sahurda mutlaka beslenmenize ek olarak lifli g─▒dalar t├╝ketin. En g├╝zel lifli g─▒dalardan biri de meyve grubudur. ├ľzellikle g├╝n i├žerisindeki enerjinizi meyvelere bor├žlusunuz. Mutlaka her sahurda 1 meyve t├╝ketmeye ├Âzen g├Âsterin. . ­čŹŻ
.
#ramadandiet#ramazandadiyet #ramadandiaries#ramazanay─▒├Ânerileri#dytsanemturkmaya #diyetg├╝nl├╝─č├╝#diyetyemektarifleri #diyetyemekleri#beslenmeg├╝nl├╝─č├╝#beslenmedanismani #diyetisyenankara#diyettavsiyeleri #beslenmegunlugum#sahurmen├╝s├╝ #ramazandadiyet#diyetekibi #diyetemazeretyok#dietmeals #dietfood #dietdiary
Diyetisyenimiz diyor ki ­čĄŚÔś║´ŞĆ Sahurda mutlaka beslenmenize ek olarak lifli g─▒dalar t├╝ketin. En g├╝zel lifli g─▒dalardan biri de meyve grubudur. ├ľzellikle g├╝n i├žerisindeki enerjinizi meyvelere bor├žlusunuz. Mutlaka her sahurda 1 meyve t├╝ketmeye ├Âzen g├Âsterin. . ­čŹŻ . #ramadandiet #ramazandadiyet  #ramadandiaries #ramazanay─▒├Ânerileri #dytsanemturkmaya  #diyetg├╝nl├╝─č├╝ #diyetyemektarifleri  #diyetyemekleri #beslenmeg├╝nl├╝─č├╝ #beslenmedanismani  #diyetisyenankara #diyettavsiyeleri  #beslenmegunlugum #sahurmen├╝s├╝  #ramazandadiyet #diyetekibi  #diyetemazeretyok #dietmeals  #dietfood  #dietdiary 
Sahurluk tarifler ­čĄŚ­čč嬭čĆ╝ Can─▒m @zeynepkiracc ­č弭čĺĽ ─▒n taba─č─▒­čśő Sahurda mutlaka beslenmenize ek olarak lifli g─▒dalar t├╝ketin. En g├╝zel lifli g─▒dalardan biri de meyve grubudur. ├ľzellikle g├╝n i├žerisindeki enerjinizi meyvelere bor├žlusunuz. Mutlaka her sahurda 1 meyve t├╝ketmeye ├Âzen g├Âsterin. #ramadandiet #ramazandadiyet #ramadandiaries #ramazanay─▒├Ânerileri #dytsanemturkmaya #diyetg├╝nl├╝─č├╝ #diyetyemektarifleri #diyetyemekleri #beslenmeg├╝nl├╝─č├╝ #beslenmedanismani #diyetisyenankara #diyettavsiyeleri #beslenmegunlugum #sahurmen├╝s├╝ #ramazandadiyet #diyetekibi #diyetemazeretyok #dietmeals #dietfood #dietdiary
Sahurluk tarifler ­čĄŚ­čč嬭čĆ╝ Can─▒m @zeynepkiracc ­č弭čĺĽ ─▒n taba─č─▒­čśő Sahurda mutlaka beslenmenize ek olarak lifli g─▒dalar t├╝ketin. En g├╝zel lifli g─▒dalardan biri de meyve grubudur. ├ľzellikle g├╝n i├žerisindeki enerjinizi meyvelere bor├žlusunuz. Mutlaka her sahurda 1 meyve t├╝ketmeye ├Âzen g├Âsterin. #ramadandiet  #ramazandadiyet  #ramadandiaries  #ramazanay─▒├Ânerileri  #dytsanemturkmaya  #diyetg├╝nl├╝─č├╝  #diyetyemektarifleri  #diyetyemekleri  #beslenmeg├╝nl├╝─č├╝  #beslenmedanismani  #diyetisyenankara  #diyettavsiyeleri  #beslenmegunlugum  #sahurmen├╝s├╝  #ramazandadiyet  #diyetekibi  #diyetemazeretyok  #dietmeals  #dietfood  #dietdiary 
Sabah kahvalt─▒da ananasl─▒ detoks suyu i├žmi┼čtim foto─čraf ├žekmeyi unuttum ­čśŐ ├Â─čle yeme─činde ─▒spanak salatal─▒k kivi ve maydanoz ile yapt─▒─č─▒m ye┼čil detoks suyu i├žtim. 1. Ara ├Â─č├╝n├╝mde Light cappuccino ve badem yedim, 2. Ara ├Â─č├╝n├╝mde bir kutu activia i├žine 2 kay─▒s─▒ 5 badem kat─▒p yedim. Ak┼čam yeme─čim 2 orta boy enginard─▒. Enginarlar─▒ rendeledim sar─▒msakl─▒ yo─čurtla kar─▒┼čt─▒rd─▒m Ôťî´ŞĆ #diet #diyet #diyetteyim #diyethesaplaritakiplesiyor #diyetyemektarifleri #diyetkarde┼čli─či #saglikliyasam #sagliklibeslenme #zayifliyorum
Sabah kahvalt─▒da ananasl─▒ detoks suyu i├žmi┼čtim foto─čraf ├žekmeyi unuttum ­čśŐ ├Â─čle yeme─činde ─▒spanak salatal─▒k kivi ve maydanoz ile yapt─▒─č─▒m ye┼čil detoks suyu i├žtim. 1. Ara ├Â─č├╝n├╝mde Light cappuccino ve badem yedim, 2. Ara ├Â─č├╝n├╝mde bir kutu activia i├žine 2 kay─▒s─▒ 5 badem kat─▒p yedim. Ak┼čam yeme─čim 2 orta boy enginard─▒. Enginarlar─▒ rendeledim sar─▒msakl─▒ yo─čurtla kar─▒┼čt─▒rd─▒m Ôťî´ŞĆ #diet  #diyet  #diyetteyim  #diyethesaplaritakiplesiyor  #diyetyemektarifleri  #diyetkarde┼čli─či  #saglikliyasam  #sagliklibeslenme  #zayifliyorum 
Diyetisyenimizden ├ľrnek ─░ftar Men├╝s├╝ ­čŹŻ 
#Repost @dytsanemturkmaya (@get_repost)
Ńâ╗Ńâ╗Ńâ╗
Herkese Hay─▒rl─▒ Ramazanlar­čÖĆ­čĆ╝ԝʭčśç Ramazan ay─▒ boyunca sizlere her g├╝n ├Ânerilerde bulunaca─č─▒m.. Bug├╝n Ramazan ay─▒nda ├Ârnek bir ─░ftar ba┼člang─▒├ž men├╝s├╝ payla┼čaca─č─▒m.. ─░ftarda midenizi yormadan k├╝├ž├╝k bir ba┼člang─▒├ž yaparak 1-2 bardak ─▒l─▒k su, ard─▒ndan hurma veya 2 kuru kay─▒s─▒, 2-3 zeytin (az tuzlu) veya 2-3 par├ža ceviz ya da 5-6 adet ├ži─č badem, 1 dilim az tuzlu peynir, 1 kep├že ├žorba, 1 avu├ž i├ži kadar pide ya da tah─▒ll─▒ ekmek t├╝ketebilirsiniz. Bu beslenmenin ard─▒ndan ise yeme─če ara verilip 15-30 dakika sonra Ana ├Â─č├╝ne ge├žerseniz sindirim daha kolay olacakt─▒r.. ­čśç #diyetteyiz #ankaradiyetisyen #ankaradiyette #dytsanemturkmaya #ramadandiaries #fastingdiettips #fastingdiet #ramadandiet #ankaradiyette #ankaradiyetisyen #diyetisyend├╝nyas─▒ #diyetisyenizmir #diyetisyenim #diyetisyen├Âneriyor #iftartaba─č─▒ #diyetg├╝nl├╝─č├╝ #diyetyemektarifleri #ho┼čgeldinramazan #ramazanay─▒├Ânerileri #ramazandadiyet
Diyetisyenimizden ├ľrnek ─░ftar Men├╝s├╝ ­čŹŻ #Repost  @dytsanemturkmaya (@get_repost) Ńâ╗Ńâ╗Ńâ╗ Herkese Hay─▒rl─▒ Ramazanlar­čÖĆ­čĆ╝ԝʭčśç Ramazan ay─▒ boyunca sizlere her g├╝n ├Ânerilerde bulunaca─č─▒m.. Bug├╝n Ramazan ay─▒nda ├Ârnek bir ─░ftar ba┼člang─▒├ž men├╝s├╝ payla┼čaca─č─▒m.. ─░ftarda midenizi yormadan k├╝├ž├╝k bir ba┼člang─▒├ž yaparak 1-2 bardak ─▒l─▒k su, ard─▒ndan hurma veya 2 kuru kay─▒s─▒, 2-3 zeytin (az tuzlu) veya 2-3 par├ža ceviz ya da 5-6 adet ├ži─č badem, 1 dilim az tuzlu peynir, 1 kep├že ├žorba, 1 avu├ž i├ži kadar pide ya da tah─▒ll─▒ ekmek t├╝ketebilirsiniz. Bu beslenmenin ard─▒ndan ise yeme─če ara verilip 15-30 dakika sonra Ana ├Â─č├╝ne ge├žerseniz sindirim daha kolay olacakt─▒r.. ­čśç #diyetteyiz  #ankaradiyetisyen  #ankaradiyette  #dytsanemturkmaya  #ramadandiaries  #fastingdiettips  #fastingdiet  #ramadandiet  #ankaradiyette  #ankaradiyetisyen  #diyetisyend├╝nyas─▒  #diyetisyenizmir  #diyetisyenim  #diyetisyen├Âneriyor  #iftartaba─č─▒  #diyetg├╝nl├╝─č├╝  #diyetyemektarifleri  #ho┼čgeldinramazan  #ramazanay─▒├Ânerileri  #ramazandadiyet 
Herkese Hay─▒rl─▒ Ramazanlar­čÖĆ­čĆ╝ԝʭčśç Ramazan ay─▒ boyunca sizlere her g├╝n ├Ânerilerde bulunaca─č─▒m.. Bug├╝n Ramazan ay─▒nda ├Ârnek bir ─░ftar ba┼člang─▒├ž men├╝s├╝ payla┼čaca─č─▒m.. ─░ftarda midenizi yormadan k├╝├ž├╝k bir ba┼člang─▒├ž yaparak 1-2 bardak ─▒l─▒k su, ard─▒ndan hurma veya 2 kuru kay─▒s─▒, 2-3 zeytin (az tuzlu) veya 2-3 par├ža ceviz ya da 5-6 adet ├ži─č badem, 1 dilim az tuzlu peynir, 1 kep├že ├žorba, 1 avu├ž i├ži kadar pide ya da tah─▒ll─▒ ekmek t├╝ketebilirsiniz. Bu beslenmenin ard─▒ndan ise yeme─če ara verilip 15-30 dakika sonra Ana ├Â─č├╝ne ge├žerseniz sindirim daha kolay olacakt─▒r.. ­čśç #diyetteyiz #ankaradiyetisyen #ankaradiyette #dytsanemturkmaya #ramadandiaries #fastingdiettips #fastingdiet #ramadandiet #ankaradiyette #ankaradiyetisyen #diyetisyend├╝nyas─▒ #diyetisyenizmir #diyetisyenim #diyetisyen├Âneriyor #iftartaba─č─▒ #diyetg├╝nl├╝─č├╝ #diyetyemektarifleri #ho┼čgeldinramazan #ramazanay─▒├Ânerileri #ramazandadiyet
Herkese Hay─▒rl─▒ Ramazanlar­čÖĆ­čĆ╝ԝʭčśç Ramazan ay─▒ boyunca sizlere her g├╝n ├Ânerilerde bulunaca─č─▒m.. Bug├╝n Ramazan ay─▒nda ├Ârnek bir ─░ftar ba┼člang─▒├ž men├╝s├╝ payla┼čaca─č─▒m.. ─░ftarda midenizi yormadan k├╝├ž├╝k bir ba┼člang─▒├ž yaparak 1-2 bardak ─▒l─▒k su, ard─▒ndan hurma veya 2 kuru kay─▒s─▒, 2-3 zeytin (az tuzlu) veya 2-3 par├ža ceviz ya da 5-6 adet ├ži─č badem, 1 dilim az tuzlu peynir, 1 kep├že ├žorba, 1 avu├ž i├ži kadar pide ya da tah─▒ll─▒ ekmek t├╝ketebilirsiniz. Bu beslenmenin ard─▒ndan ise yeme─če ara verilip 15-30 dakika sonra Ana ├Â─č├╝ne ge├žerseniz sindirim daha kolay olacakt─▒r.. ­čśç #diyetteyiz  #ankaradiyetisyen  #ankaradiyette  #dytsanemturkmaya  #ramadandiaries  #fastingdiettips  #fastingdiet  #ramadandiet  #ankaradiyette  #ankaradiyetisyen  #diyetisyend├╝nyas─▒  #diyetisyenizmir  #diyetisyenim  #diyetisyen├Âneriyor  #iftartaba─č─▒  #diyetg├╝nl├╝─č├╝  #diyetyemektarifleri  #ho┼čgeldinramazan  #ramazanay─▒├Ânerileri  #ramazandadiyet 
Kolayca Kalori Yakman─▒n 20 Yolu ÔÇô A├ž kalmak u─čruna diyetler yapmadan ya┼čam tarz─▒ndan ├Âd├╝n vermeden kilo verebilirsiniz bunun i├žin a┼ča─č─▒daki 20 kurala dikkat etmeniz gerekiyor ├Âzellikle.. Yaz─▒n─▒n devam─▒ i├žin fithatun.com a beklerim, siteye bio'dan da ula┼čabilirsiniz. #diyetyemekleri #diyet #diyetteyiz #sagliklibeslenme #diyetonerileri #diyetkarde┼čligi #diyetteyim #fityasam #diyetyemektarifleri #gobekeritme #zayiflama #diyettarifler #zayiflamak #yemektarifleri #diet #spor #diyetyemekleri #zayiflamak #sagliklibeslenme #zayif #diyetteyim #fithatun
Kolayca Kalori Yakman─▒n 20 Yolu ÔÇô A├ž kalmak u─čruna diyetler yapmadan ya┼čam tarz─▒ndan ├Âd├╝n vermeden kilo verebilirsiniz bunun i├žin a┼ča─č─▒daki 20 kurala dikkat etmeniz gerekiyor ├Âzellikle.. Yaz─▒n─▒n devam─▒ i├žin fithatun.com a beklerim, siteye bio'dan da ula┼čabilirsiniz. #diyetyemekleri  #diyet  #diyetteyiz  #sagliklibeslenme  #diyetonerileri  #diyetkarde┼čligi  #diyetteyim  #fityasam  #diyetyemektarifleri  #gobekeritme  #zayiflama  #diyettarifler  #zayiflamak  #yemektarifleri  #diet  #spor  #diyetyemekleri  #zayiflamak  #sagliklibeslenme  #zayif  #diyetteyim  #fithatun 
160 Kalorilik F─▒r─▒nda Sebze T├╝rl├╝s├╝

Diyet yapan g├╝zel hatunlar─▒m─▒za, mis gibi bir t├╝rl├╝ tarifi, hem de olabildi─čince diyet ve d├╝┼č├╝k kalorili :) Yaz─▒n─▒n devam─▒ i├žin fithatun.com a beklerim, siteye bio'dan da ula┼čabilirsiniz. #diyetyemekleri #diyet #diyetteyiz #sagliklibeslenme #diyetonerileri #diyetkarde┼čligi #diyetteyim #fityasam #diyetyemektarifleri #gobekeritme #zayiflama #diyettarifler #zayiflamak #yemektarifleri #diet #spor #diyetyemekleri #zayiflamak #sagliklibeslenme #zayif #diyetteyim #fithatun
160 Kalorilik F─▒r─▒nda Sebze T├╝rl├╝s├╝ Diyet yapan g├╝zel hatunlar─▒m─▒za, mis gibi bir t├╝rl├╝ tarifi, hem de olabildi─čince diyet ve d├╝┼č├╝k kalorili :) Yaz─▒n─▒n devam─▒ i├žin fithatun.com a beklerim, siteye bio'dan da ula┼čabilirsiniz. #diyetyemekleri  #diyet  #diyetteyiz  #sagliklibeslenme  #diyetonerileri  #diyetkarde┼čligi  #diyetteyim  #fityasam  #diyetyemektarifleri  #gobekeritme  #zayiflama  #diyettarifler  #zayiflamak  #yemektarifleri  #diet  #spor  #diyetyemekleri  #zayiflamak  #sagliklibeslenme  #zayif  #diyetteyim  #fithatun 
Kahvaltimi erkenden yaptim .Bollll kalorili pazar kahvaltilarina kurban gitmemek icin­čśâ sizinde e┼činiz ├žok i┼čtahl─▒ ise,ondan erken kalkip yiyin .sonra ipin ucu ka├ž─▒yor .:) #breakfast #diyet #diyetkahvalti #diyetyemektarifleri #diyetyemekleri #sagliklidiyet #saglikliyasiyoruz #diet #dieta #diets #dietfood #dietfoods #dietfail #dietfoodsdelivery #fit #fitmama #fitbosy #stayfit #fitmom #fitanneler #fitgirl #form #motivation
Kahvaltimi erkenden yaptim .Bollll kalorili pazar kahvaltilarina kurban gitmemek icin­čśâ sizinde e┼činiz ├žok i┼čtahl─▒ ise,ondan erken kalkip yiyin .sonra ipin ucu ka├ž─▒yor .:) #breakfast  #diyet  #diyetkahvalti  #diyetyemektarifleri  #diyetyemekleri  #sagliklidiyet  #saglikliyasiyoruz  #diet  #dieta  #diets  #dietfood  #dietfoods  #dietfail  #dietfoodsdelivery  #fit  #fitmama  #fitbosy  #stayfit  #fitmom  #fitanneler  #fitgirl  #form  #motivation 
360 kcal­čĺ¬Ak┼čam yeme─čim­čĹł
F─▒r─▒n m├╝cver m├╝kemmel oldu unsuz­čśŐ
B├Âbrekten ne fark─▒ var simdi bunun ne gerek var b├Âre─če ÔČç
1 dilim kabak m├╝cver 116 kcalÔťöÔťö
#diyet #diyetteyiz #diyetkarde┼čligi #diyetyemektarifleri #ak┼čamlar #ak┼čamyemegi #zayiflama #zayiflamakistiyorum #zay─▒folacag─▒n─▒zg├╝nlerihayaledin­čĹŹisteyin­čĹŹba┼čaracaks─▒n─▒z
Oglen resmi yaynlamakta gec kaldim..domatesli bulgur pilavi bol yesil peynirli salata #saglikliyasam #saglibesleniyorum #diyettekilertakiple┼čiyor #diyetteyim #diyetyemektarifleri #food­čśŹ #foodpic #likesforlikes #like4like
Kinoa, esmer bulgur, ─▒spanak, kuru so─čan ve domates bir araya geldi─či i├žin ├žok sa─čl─▒kl─▒ bir yemek oldu. ─░├žim nas─▒l rahat yiyorum, vicdan─▒m nas─▒l hafif ku┼člar gibi!ÔÇŽ. ­čśÇ
. . . . ­čąĽ­čƭ菏Bu yemek ├Âzellikle ─▒spanak fanlar─▒n─▒n favorisi olacak. O kadar hafifi ve lezzetli oldu ki ­čĄĄ­čśőDiyet yapan yapmayan bu yeme─či mutlaka yapmal─▒.
. . . .
­čôŁ TAR─░F─░ ─░├ç─░N: http://denizinyemektarifleri.com/kinoali-kabakli-ispanak/ ­čĹîwww.DenizinYemekTarifleri.com
. .
#kinoa #kabak #zucchini #─▒spanak #spinach #─▒spanakyeme─čitarifleri #yemektarifleri #sebzeyemekleri #sebzeyemekleritarifleri #sa─čl─▒kl─▒yemekler #diyetyemekler #diyetteyiz #diet #diyet #diyetyeme─čitarifleri #denizinyemektarifleri #diyetyemektarifleri #dietrecipes #kabakyeme─či #─▒spanakyeme─či #kinoal─▒tarifler #kinoarecipes #mutfa─č─▒m #tariflerim #myrecipes #mykitchen #gastronomia #gastronomik
Kinoa, esmer bulgur, ─▒spanak, kuru so─čan ve domates bir araya geldi─či i├žin ├žok sa─čl─▒kl─▒ bir yemek oldu. ─░├žim nas─▒l rahat yiyorum, vicdan─▒m nas─▒l hafif ku┼člar gibi!ÔÇŽ. ­čśÇ . . . . ­čąĽ­čƭ菏Bu yemek ├Âzellikle ─▒spanak fanlar─▒n─▒n favorisi olacak. O kadar hafifi ve lezzetli oldu ki ­čĄĄ­čśőDiyet yapan yapmayan bu yeme─či mutlaka yapmal─▒. . . . . ­čôŁ TAR─░F─░ ─░├ç─░N: http://denizinyemektarifleri.com/kinoali-kabakli-ispanak/ ­čĹîwww.DenizinYemekTarifleri.com . . #kinoa  #kabak  #zucchini  #─▒spanak  #spinach  #─▒spanakyeme─čitarifleri  #yemektarifleri  #sebzeyemekleri  #sebzeyemekleritarifleri  #sa─čl─▒kl─▒yemekler  #diyetyemekler  #diyetteyiz  #diet  #diyet  #diyetyeme─čitarifleri  #denizinyemektarifleri  #diyetyemektarifleri  #dietrecipes  #kabakyeme─či  #─▒spanakyeme─či  #kinoal─▒tarifler  #kinoarecipes  #mutfa─č─▒m  #tariflerim  #myrecipes  #mykitchen  #gastronomia  #gastronomik 
G├╝nayd─▒n­čî×­čŽő­čÄëÔťĘ Az de─čil sa─čl─▒kl─▒ beslenmeyi tercih edin, a├ž b─▒rakan diyetlerden uzak durun ­č嬭čĆ╝ #dytsanemturkmaya #diyetidiyetisyenyazar #diyettavsiyeleri #dietmeals #diyetyemektarifleri #ankaradiyet #antalya #ankaradiyette #diyetisyenim #beslenmedanismani #diyetisyenankara #diyetisyend├╝nyas─▒ #sporvediyet
Kahvalt─▒ zaman─▒ ­čŹ│­čŹ│­čŹ│ / Breakfast time!! ÔĆ░10.10
Ton Bal─▒kl─▒ ┼×ok Diyet 2. G├╝n­čĺą­čĺą- Tuna Fish Shock Diet 2nd Day
'
'
­čĺÜ1 tam pi┼čmi┼č yumurta, maydanozun alt─▒na saklanm─▒┼č 1 dilim peynir­čÖł can─▒m ├žekti diye 1 ka┼č─▒k ya─čs─▒z biber-domates ­čśŤ­čśŤve 1 bardak a├ž─▒k ├žay / an egg, slice of cheese, tomato&pepper mix and glass of tea
'
#kahvalti #diet #diyetyemektarifleri #diyetzamani #kiloverme #diyetkardesligi #dietfood #egg #tomato  #yummy
Kahvalt─▒ zaman─▒ ­čŹ│­čŹ│­čŹ│ / Breakfast time!! ÔĆ░10.10 Ton Bal─▒kl─▒ ┼×ok Diyet 2. G├╝n­čĺą­čĺą- Tuna Fish Shock Diet 2nd Day ' ' ­čĺÜ1 tam pi┼čmi┼č yumurta, maydanozun alt─▒na saklanm─▒┼č 1 dilim peynir­čÖł can─▒m ├žekti diye 1 ka┼č─▒k ya─čs─▒z biber-domates ­čśŤ­čśŤve 1 bardak a├ž─▒k ├žay / an egg, slice of cheese, tomato&pepper mix and glass of tea ' #kahvalti  #diet  #diyetyemektarifleri  #diyetzamani  #kiloverme  #diyetkardesligi  #dietfood  #egg  #tomato  #yummy 
├ľ─čle yeme─čim ├╝├ž k├Âfte ve yo─čurtlu kabak­čśë kaba─č─▒ ├ži─čden rendeliyorum sar─▒msakl─▒ yo─čurtla kar─▒┼čt─▒r─▒yorum ├╝st├╝ne de nane d├Âk├╝yorum muhte┼čem oluyor Ôťî´ŞĆ #diet #diyet #diyetyemekleri #diyetteyim #diyetyemektarifleri #diyethesaplaritakiplesiyor #diyetkolik
­čÖîUn yok! ┼×eker yok! Ya─č yok! Yumurta yok! ­čĹŹ­čĹŹ­čĹŹMuz, bal, yulaf ezmesi, kakao tozu, kuru meyve ve yemi┼člerle efsane ve diyet bir kurabiye yapt─▒k­čśü­čśü­čśü Tok tutuyor, y├╝ksek lif i├žeriyor, enerji veriyor, metabolizma h─▒zland─▒r─▒yor­čĹĆ­čĹĆ­čĹĆ­čĹĆ
.
­čĹęÔÇŹ­čŹ│
.
TAR─░F─░:
http://denizinyemektarifleri.com/yulafli-diyet-kurabiye/
... . 
www.DenizinYemekTarifleri.com
... . 
#diyettarifler #diyetyemektarifleri #denizinyemektarifleri #kurabiyetarifleri #kurabiye #yulafl─▒kurabiye #yulafezmesi #yulafezmelitarifler #yemektarifleri #diyet #rejim #diyetteyiz #sa─čl─▒kl─▒yemekler #sa─čl─▒kl─▒tarifler #healthyrecipes #mutfa─č─▒m #tariflerim
­čÖîUn yok! ┼×eker yok! Ya─č yok! Yumurta yok! ­čĹŹ­čĹŹ­čĹŹMuz, bal, yulaf ezmesi, kakao tozu, kuru meyve ve yemi┼člerle efsane ve diyet bir kurabiye yapt─▒k­čśü­čśü­čśü Tok tutuyor, y├╝ksek lif i├žeriyor, enerji veriyor, metabolizma h─▒zland─▒r─▒yor­čĹĆ­čĹĆ­čĹĆ­čĹĆ . ­čĹęÔÇŹ­čŹ│ . TAR─░F─░: http://denizinyemektarifleri.com/yulafli-diyet-kurabiye/ ... . www.DenizinYemekTarifleri.com ... . #diyettarifler  #diyetyemektarifleri  #denizinyemektarifleri  #kurabiyetarifleri  #kurabiye  #yulafl─▒kurabiye  #yulafezmesi  #yulafezmelitarifler  #yemektarifleri  #diyet  #rejim  #diyetteyiz  #sa─čl─▒kl─▒yemekler  #sa─čl─▒kl─▒tarifler  #healthyrecipes  #mutfa─č─▒m  #tariflerim 
S├╝tl├╝ karabu─čday ├žorbas─▒ ­čąĽ­čŹÁ­čĹîbu g├╝n├╝n sonu ve ak┼čam yeme─čim­čśő bu seferki ye┼čil de─čil­čĺÜ­čśé­čśé 1 yk karabu─čday
1 havu├ž­čąĽ
1 ├žay barda─č─▒ laktozsuz s├╝t
1 ├žay barda─č─▒ su
Maydonoz
1 yk s─▒zma zeytinya─č
1 adet k├╝├ž├╝k kuru so─čan
1 ├žk karabiber 
Zeytinya─č─▒ ile k├╝├ž├╝k do─čranm─▒┼č so─čan─▒ pembele┼čene kadar kavural─▒m. Havu├žlar─▒ minik k├╝p ┼čeklinde do─črayal─▒m. Karabu─čday ve havucu ekleyip kar─▒┼čt─▒ral─▒m.
S├╝t├╝ ve suyu ekleyelim. Havu├žlar yumu┼čay─▒ncaya kadar k─▒s─▒k ate┼čte pi┼čirelim. ─░sterseniz blenderdan ge├žirebilirsiniz. Ben taneli tercih ettim. En son k─▒y─▒lm─▒┼č maydonozu ve karabiberi ekleyin. 
#sa─čl─▒kl─▒beslenme #healthyfood #diyetyemektarifleri #umayvilladetoks #soup #├žorba #filizceyemekler #diyetteyim #karabu─čdayl─▒├žorba #mutfakgram #gram├žorba #yasamutfakta #yemekrium #lezzetligram #tariflilezzetler #yemek #├žorbaburada #├žorbaburda
S├╝tl├╝ karabu─čday ├žorbas─▒ ­čąĽ­čŹÁ­čĹîbu g├╝n├╝n sonu ve ak┼čam yeme─čim­čśő bu seferki ye┼čil de─čil­čĺÜ­čśé­čśé 1 yk karabu─čday 1 havu├ž­čąĽ 1 ├žay barda─č─▒ laktozsuz s├╝t 1 ├žay barda─č─▒ su Maydonoz 1 yk s─▒zma zeytinya─č 1 adet k├╝├ž├╝k kuru so─čan 1 ├žk karabiber Zeytinya─č─▒ ile k├╝├ž├╝k do─čranm─▒┼č so─čan─▒ pembele┼čene kadar kavural─▒m. Havu├žlar─▒ minik k├╝p ┼čeklinde do─črayal─▒m. Karabu─čday ve havucu ekleyip kar─▒┼čt─▒ral─▒m. S├╝t├╝ ve suyu ekleyelim. Havu├žlar yumu┼čay─▒ncaya kadar k─▒s─▒k ate┼čte pi┼čirelim. ─░sterseniz blenderdan ge├žirebilirsiniz. Ben taneli tercih ettim. En son k─▒y─▒lm─▒┼č maydonozu ve karabiberi ekleyin. #sa─čl─▒kl─▒beslenme  #healthyfood  #diyetyemektarifleri  #umayvilladetoks  #soup  #├žorba  #filizceyemekler  #diyetteyim  #karabu─čdayl─▒├žorba  #mutfakgram  #gram├žorba  #yasamutfakta  #yemekrium  #lezzetligram  #tariflilezzetler  #yemek  #├žorbaburada  #├žorbaburda 
K─▒s─▒r m─▒─▒─▒─▒ zeytinya─čl─▒─▒ m─▒─▒─▒ ­čśŹ­čśŹ­čśŹ­čĺÜ­čĺÜ­čĺÜ #diyetyemektarifleri #diyetteyiz #diyet #zumbaÔŁĄ´ŞĆ #fitness #fitbayanolmayolunda #zay─▒fl─▒yoruz #kiloverme #zay─▒flama #pilates #bfitkad─▒n─▒ #bfit
Cevizli, karabu─čdayl─▒ ─▒spanak yeme─čim­čŹâ­čŹâ­čŹÁ­čĹî bu sabah saat 10'da pilatesim vard─▒.. kahvalt─▒m bu y├╝zden ge├ž oldu. Spor sonras─▒ kabakl─▒ omletimi yedim.. ├Â─čle yeme─či ancak bu saate kald─▒, ger├ži burada ├Â─čle yemekleri 2'den sonra oluyor­čśś­čśś 1/2demet ─▒spanak
4 adet ceviz
1 yk ha┼članm─▒┼č karabu─čday
1 yk s─▒zma zeytinya─č
1 ├žk kimyon
2 di┼č sar─▒msak
Zeytinya─č─▒nda sar─▒msaklar─▒ ve ─▒spana─č─▒ soteledim. Karabu─čday ve  cevizi ekledim. ├çok az su ile pi┼čirdim. En son kimyonu kat─▒p kar─▒┼čt─▒rd─▒m ve ya─čs─▒z yo─čurtla yeme─čimi yedim­čśő­čĹî­čĹî­čÖő­čĆ╝ #─▒spanakyeme─či #filizceyemekler #diyetteyim #diyetyemektarifleri #healthyfood #umayvilladetoks #food #sa─čl─▒kl─▒beslenme #nofilter #yemek #yasamutfakta #tariflilezzetler
Cevizli, karabu─čdayl─▒ ─▒spanak yeme─čim­čŹâ­čŹâ­čŹÁ­čĹî bu sabah saat 10'da pilatesim vard─▒.. kahvalt─▒m bu y├╝zden ge├ž oldu. Spor sonras─▒ kabakl─▒ omletimi yedim.. ├Â─čle yeme─či ancak bu saate kald─▒, ger├ži burada ├Â─čle yemekleri 2'den sonra oluyor­čśś­čśś 1/2demet ─▒spanak 4 adet ceviz 1 yk ha┼članm─▒┼č karabu─čday 1 yk s─▒zma zeytinya─č 1 ├žk kimyon 2 di┼č sar─▒msak Zeytinya─č─▒nda sar─▒msaklar─▒ ve ─▒spana─č─▒ soteledim. Karabu─čday ve cevizi ekledim. ├çok az su ile pi┼čirdim. En son kimyonu kat─▒p kar─▒┼čt─▒rd─▒m ve ya─čs─▒z yo─čurtla yeme─čimi yedim­čśő­čĹî­čĹî­čÖő­čĆ╝ #─▒spanakyeme─či  #filizceyemekler  #diyetteyim  #diyetyemektarifleri  #healthyfood  #umayvilladetoks  #food  #sa─čl─▒kl─▒beslenme  #nofilter  #yemek  #yasamutfakta  #tariflilezzetler 
Ablam─▒n elinden biber dolmas─▒. ak┼čamki tavuk yeme─či yerine Ôťî´ŞĆ#diet #diyet #diyetteyim #diyetyemektarifleri #diyetkolik #diyethesaplaritakiplesiyor #diyetkardesligi #sagliklibeslenme #saglikliyasam
Kahvalt─▒n─▒n mutlulukla bir ilgisi var ­čĺÜ yine herkes uyurken kalk─▒p erkenden kahvalt─▒m─▒ haz─▒rlay─▒p yapt─▒m bu sabah da ├╝┼čenmedi─čim i├žin ├žok mesudum ­čśŹ #diyetyemektarifleri #diyet #kiloverme #kilovermenintad─▒hi├žbiryemekteyok #zay─▒fl─▒yoruz #sadeceinan #fitbayanolmayolunda #fitolucaz #o60burayagelecek #hedeffit #zumba #pilates #fitnessmotivation #evdespor #zay─▒flama #yulaf #Motivasyon #zayiflamagunlugu #diyetkardesligi
Kahvalt─▒n─▒n mutlulukla bir ilgisi var ­čĺÜ yine herkes uyurken kalk─▒p erkenden kahvalt─▒m─▒ haz─▒rlay─▒p yapt─▒m bu sabah da ├╝┼čenmedi─čim i├žin ├žok mesudum ­čśŹ #diyetyemektarifleri  #diyet  #kiloverme  #kilovermenintad─▒hi├žbiryemekteyok  #zay─▒fl─▒yoruz  #sadeceinan  #fitbayanolmayolunda  #fitolucaz  #o60burayagelecek  #hedeffit  #zumba  #pilates  #fitnessmotivation  #evdespor  #zay─▒flama  #yulaf  #Motivasyon  #zayiflamagunlugu  #diyetkardesligi