an online Instagram web viewer

#hotels medias

Photos

HarleyAndLolainteriors

The Verdi 2 Seat Garden Bench Seat comes with a plush seat pad for total relaxation. Crafted in serene green and warm natural wood, this bench is ideal for those contemplative moments by nature.
Match with other items from the Verdi range.
The vintage beauty of the Verdi range from Norfolk Leisure will bring a calming influence to your outdoor space. Elegantly fashioned from 100% certified eucalyptus wood and finished in a cool green painted and teak look finish.

http://ow.ly/UiGo30d0Ghf

#worcester #worcestershire #pershore #evesham #bromsgrove #droitwich #stourport #Kidderminster #greatmalvern #malvern #malvernhills #loveworcester #westmidlands #redditch #ledbury #droitwichspa #droitwich #magazine #lifestyle #ukholidays #home #hotels #homefurniture
#care #restaurants #eatingout
www.countylifestyleandleisure.com read online or in print for FREE every month.
Add us on facebook, www.facebook.com/countylifestyle
HarleyAndLolainteriors The Verdi 2 Seat Garden Bench Seat comes with a plush seat pad for total relaxation. Crafted in serene green and warm natural wood, this bench is ideal for those contemplative moments by nature. Match with other items from the Verdi range. The vintage beauty of the Verdi range from Norfolk Leisure will bring a calming influence to your outdoor space. Elegantly fashioned from 100% certified eucalyptus wood and finished in a cool green painted and teak look finish. http://ow.ly/UiGo30d0Ghf #worcester  #worcestershire  #pershore  #evesham  #bromsgrove  #droitwich  #stourport  #Kidderminster  #greatmalvern  #malvern  #malvernhills  #loveworcester  #westmidlands  #redditch  #ledbury  #droitwichspa  #droitwich  #magazine  #lifestyle  #ukholidays  #home  #hotels  #homefurniture  #care  #restaurants  #eatingout  www.countylifestyleandleisure.com read online or in print for FREE every month. Add us on facebook, www.facebook.com/countylifestyle
#blackandwhite #traveling #hotels .It happened to have light exposure and angle fitting the camera :))
#palaissaleya makes YOU feel special😊 photo by : @pierreturtaut
#palaissaleya  makes YOU feel special😊 photo by : @pierreturtaut
Le nostre insalatone sono fresche e deliziose, per un pranzo leggero e pieno di gusto!
E' ora di pranzo....vi aspettiamo! 
www.hotelnapoleon.org
Le nostre insalatone sono fresche e deliziose, per un pranzo leggero e pieno di gusto! E' ora di pranzo....vi aspettiamo! www.hotelnapoleon.org
Sexy swirls,
Seductive curls,
With the eye of a pearl.

#cakes #eat #food #potd #drinks #hotels #travel #custard #sweets #plates #designs #spoons #tattoos #birmingham #coffee #tea #poetry #writers #haiku #cream #quotes #funny #breakfast #thoughts
Oh that feeling! Such joy! 💃Don't just build hotels in monopoly, invest enough to have lasting income in real life! After this long weekend, we are happy to get back to work! 😀😎💸💵💰
__
#monopoly #hotels #investment #weekend #happy #newweek #makemoney #wednesday #monopolymoney #money #gains
Oh that feeling! Such joy! 💃Don't just build hotels in monopoly, invest enough to have lasting income in real life! After this long weekend, we are happy to get back to work! 😀😎💸💵💰
__
#monopoly #hotels #investment #weekend #happy #newweek #makemoney #wednesday #monopolymoney #money #gains
#HarleyAndLolainteriors

This Antigua Corner Set will complement any corner space in a garden or patio, creating a comfortable area for relaxing, eating and drinking. Comprising of one glass topped coffee table, two comfortable double sofas and one cosy corner sofa. The set is made from an attractive half round weave in a subtle slate grey, and the whole set is weather and UV protected.
The aluminium frame is powder coated for protection against corrosion. The outdoor cushions are shower proof and the table top has tempered safety glass.
All frames should be cleaned by gently wiping with a soft dry cloth, abrasive and chemical cleaners should not be used. All fabric covers should be removed for cleaning - dry clean only.

http://ow.ly/RuOy30d0G0w

#worcester #worcestershire #pershore #evesham #bromsgrove #droitwich #stourport #Kidderminster #greatmalvern #malvern #malvernhills #loveworcester #westmidlands #redditch #ledbury #droitwichspa #droitwich #magazine #lifestyle #ukholidays #home #hotels #homefurniture
#care #restaurants #eatingout
www.countylifestyleandleisure.com read online or in print for FREE every month.
Add us on facebook, www.facebook.com/countylifestyle
#HarleyAndLolainteriors  This Antigua Corner Set will complement any corner space in a garden or patio, creating a comfortable area for relaxing, eating and drinking. Comprising of one glass topped coffee table, two comfortable double sofas and one cosy corner sofa. The set is made from an attractive half round weave in a subtle slate grey, and the whole set is weather and UV protected. The aluminium frame is powder coated for protection against corrosion. The outdoor cushions are shower proof and the table top has tempered safety glass. All frames should be cleaned by gently wiping with a soft dry cloth, abrasive and chemical cleaners should not be used. All fabric covers should be removed for cleaning - dry clean only. http://ow.ly/RuOy30d0G0w #worcester  #worcestershire  #pershore  #evesham  #bromsgrove  #droitwich  #stourport  #Kidderminster  #greatmalvern  #malvern  #malvernhills  #loveworcester  #westmidlands  #redditch  #ledbury  #droitwichspa  #droitwich  #magazine  #lifestyle  #ukholidays  #home  #hotels  #homefurniture  #care  #restaurants  #eatingout  www.countylifestyleandleisure.com read online or in print for FREE every month. Add us on facebook, www.facebook.com/countylifestyle
Seguimos llenando nuestro junio de verano para trasladarnos esta vez a Capri, donde nos espera el Villa Marina para deslumbrarnos con todo el azul del Mediterráneo italiano, tentarnos con gastronomía local y hacernos creer en un estío eterno.

#VillaMarinaCapri #Italia #Sicilia #Sicily #Sea #Italy #MediterraneanSea #photooftheday #picoftheday #instatravel #instagood #instadaily #travelgram #bestoftheday #igdaily #instafood #hotels #besthotels #luxuryhotel #boutiquehotel #luxurytraveller #pool #hoteldeals
Seguimos llenando nuestro junio de verano para trasladarnos esta vez a Capri, donde nos espera el Villa Marina para deslumbrarnos con todo el azul del Mediterráneo italiano, tentarnos con gastronomía local y hacernos creer en un estío eterno. #VillaMarinaCapri  #Italia  #Sicilia  #Sicily  #Sea  #Italy  #MediterraneanSea  #photooftheday  #picoftheday  #instatravel  #instagood  #instadaily  #travelgram  #bestoftheday  #igdaily  #instafood  #hotels  #besthotels  #luxuryhotel  #boutiquehotel  #luxurytraveller  #pool  #hoteldeals 
Oh that feeling! Such joy! 💃Don't just build hotels in monopoly, invest enough to have lasting income in real life! After this long weekend, we are happy to get back to work! 😀😎💸💵💰
__
#monopoly #hotels #investment #weekend #happy #newweek #makemoney #wednesday #monopolymoney #money #gains
At the glide Bar, have a drink and enjoy Siem Reap from above. See you tonight! #rooftop #skybar #hotels #siemreap #cambodia #cocktails🍹
‏عسى الله يجملنا مع اصحابنا الغالين ‏وعسى من هقى فينا نجي فوق هقواته ‏وعسى علومنا بالطيب تذكر مع الوافين ‏وعسى الله يرزقنا ب عفوه وجناته❤️
•••••••••••
#uae #dubai #investment #invest #realestate #jeddah #riyadh #lebanon #saudiarabia #business #dream #success #seahorse #italy #towers #tower #luxury #hotels #qatar #kuwait #bahrain #abudahbi #jordan #egypt #oman  #usa #UK #عبدالله_دانش
‏عسى الله يجملنا مع اصحابنا الغالين ‏وعسى من هقى فينا نجي فوق هقواته ‏وعسى علومنا بالطيب تذكر مع الوافين ‏وعسى الله يرزقنا ب عفوه وجناته❤️ ••••••••••• #uae  #dubai  #investment  #invest  #realestate  #jeddah  #riyadh  #lebanon  #saudiarabia  #business  #dream  #success  #seahorse  #italy  #towers  #tower  #luxury  #hotels  #qatar  #kuwait  #bahrain  #abudahbi  #jordan  #egypt  #oman  #usa  #UK  #عبدالله_دانش 
Fantastisch!!! 👍 ...dieser Blick vom Schloss Neuschwanstein zum Schloss Hohenschwangau. Ich musste diese wunderschöne Aussicht fotografieren 🤳 #hohenschwangau#Neuschwanstein #wonderfulnature#photographers#allgäu#füssen#fantastic#picoftheday#landscape#naturelovers#castle#berge#aussicht#instanature#instalovers#swag#omg#photooftheday#instafollow#great#china#hotels#instacool#instagrammer#instablogger#germany
Oh that feeling! Such joy! 💃Don't just build hotels in monopoly, invest enough to have lasting income in real life! After this long weekend, we are happy to get back to work! 😀😎💸💵💰
__
#monopoly #hotels #investment #weekend #happy #newweek #makemoney #wednesday #monopolymoney #money #gains
Moments de pura diversió amb el nostre equip d'animació! 🎉🎉🏀
#hotels #hoteldonjuan #GranHotelDonJuan #GranHotelDonJuanPace #HotelDonJuanTossa #basketball #fun #summer #currentmood #goodvibes
Sunrise in Love Valley Goreme Cappadocia............. 🔖  Cappadocia 🔖
Tag 📌 someone you want go with ............
📍Location #goreme #cappadocia #turkey 📸 by : @selenastribling
Sunrise in Love Valley Goreme Cappadocia............. 🔖 Cappadocia 🔖 Tag 📌 someone you want go with ............ 📍Location #goreme  #cappadocia  #turkey  📸 by : @selenastribling
School holidays are just around the corner. Do you have your plans finalized?
.
.
.
.
.
.
.
.
.
#schoolholidays #socialevent #corporatefunction #sydney #coogee #coogeebeach #nsw #hotellife #hotels #ihg #crowneplazacoogee #crowneplaza #dining #sydneyfood #sydneyfoodbloggers #sydney #restaurant #destinationnsw #tourismsydney
Cooking with the DISSNA Precision Cooker is Pure Magic!  Create amazing dishes, just like a Star-Chef….
The new generation ... with the DISSNA WI-FI App

This fascinating device, with the latest technology, will help you bring your daily meals to perfection. The award-winning Dissna App ‘Cook Pro’ gives you full control, all the time, wherever you might be in your home. The circulator can be controlled and monitored via Wi-Fi using your smartphone. The DISSNA Precision Cooker is also equipped with a user-friendly touch screen, and the illuminated LED stripe tells you which mode the circulator is in.

#bbq #cooking #sousvide #kochen #foodporn#foodlab#vacstar#food#vacuumpackaging#vacuumpacker#vacuumpacking#vacuumpacked#hotel#gastro#gourmet#Instafood #cook #FoodLovers #foodpics #foods#hotel#hotels#restaurant#restaurants#gourmet#catering#chefsofinstagram#cheflife#chef#chefs#cheftalk
Cooking with the DISSNA Precision Cooker is Pure Magic! Create amazing dishes, just like a Star-Chef…. The new generation ... with the DISSNA WI-FI App This fascinating device, with the latest technology, will help you bring your daily meals to perfection. The award-winning Dissna App ‘Cook Pro’ gives you full control, all the time, wherever you might be in your home. The circulator can be controlled and monitored via Wi-Fi using your smartphone. The DISSNA Precision Cooker is also equipped with a user-friendly touch screen, and the illuminated LED stripe tells you which mode the circulator is in. #bbq  #cooking  #sousvide  #kochen  #foodporn #foodlab #vacstar #food #vacuumpackaging #vacuumpacker #vacuumpacking #vacuumpacked #hotel #gastro #gourmet #Instafood  #cook  #FoodLovers  #foodpics  #foods #hotel #hotels #restaurant #restaurants #gourmet #catering #chefsofinstagram #cheflife #chef #chefs #cheftalk 
Suites at The Oberoi, Mumbai are made of unparelleled views and exquisite settings. #InsideOberoi @OberoiHotels
#Corners #Details #Hotels #Hospitality #Relax #Luxury #Travel #Travelstagram #InstaTravel #TravelDiaries #Memories #Interiors #Decor #LuxuryLife #Happiness
Keep calm... and celebrate the end of the exams! Vacation time! 😄🎉
Pic by @saarahammar
Keep calm... and celebrate the end of the exams! Vacation time! 😄🎉 Pic by @saarahammar
Merhabalar, cennetten bir köşe olan "Cumbalı Konak Otel'de" tatlı bir kahve molası.😍 Çok mekan geziyorum ama ruhuma dokunan oteller hep ayrı bir köşede oluyor. İşte @cumbalikonak 'da bunlardan biri; görüntüsüyle, anılarıyla, kokusuyla, varolan veya çağrışım yapan beni sarıp sarmalayan çok özel bir otel.
Abartmıyorum dünyada gidilmesi gerekenler listenize ekleyin! Bu ruh ile bütünleşin ve hayatı yeniden kutlamak için kendinize şans verin. 
Detaylar yakında www.kesifperisi.com'da yer alacak.👌💐💐
____________________________________________

#cumbalikonakhotel #alacati #izmir #cumbalikonak #beach  #pool #manzara #wiev #deniz #tatil #holiday #travel #love #girlythings #coffee #kesifperisi #hotel #hotels #turkeyhotels #bodrumhotels #sea #blogger #lukshotel #cumbaliotel #havuz #cesme #breakfast #kahve
Merhabalar, cennetten bir köşe olan "Cumbalı Konak Otel'de" tatlı bir kahve molası.😍 Çok mekan geziyorum ama ruhuma dokunan oteller hep ayrı bir köşede oluyor. İşte @cumbalikonak 'da bunlardan biri; görüntüsüyle, anılarıyla, kokusuyla, varolan veya çağrışım yapan beni sarıp sarmalayan çok özel bir otel. Abartmıyorum dünyada gidilmesi gerekenler listenize ekleyin! Bu ruh ile bütünleşin ve hayatı yeniden kutlamak için kendinize şans verin. Detaylar yakında www.kesifperisi.com'da yer alacak.👌💐💐 ____________________________________________ #cumbalikonakhotel  #alacati  #izmir  #cumbalikonak  #beach  #pool  #manzara  #wiev  #deniz  #tatil  #holiday  #travel  #love  #girlythings  #coffee  #kesifperisi  #hotel  #hotels  #turkeyhotels  #bodrumhotels  #sea  #blogger  #lukshotel  #cumbaliotel  #havuz  #cesme  #breakfast  #kahve 
Save the dates!. Heineken Lagos Fashion and Design Week @lfdw_ng is happening on the 25th - 28 October 2017. #HEINEKENLFDW17 #LFDW17 #advertise #advert #marketing #onlinemarketing #digitalmarketing #growbusiness #abuja #london  #unitedstates #southafrica #lagosnigeria #brands #sme #company #hotels #restaurants #instastyle #instafashion #instafollow #instalike
Good morning from the K+K Hotel Picasso rooftop! 
#Terrace #Rooftop #View #Ciutadellapark #Sea #Barcelona #Spain #KKhotelPicasso
#Лєда_Компанія
.
Готельно-ресторанний комплекс "Козацький стан" це чудове місце для відпочинку у вихідний день! Особливо, коли вся країна святкує День Конституції!
.
Ми щиро вітаємо усіх Українців!
.
#vscofood #rest #havingrest #vscocam #nature #козацькийстан #природа #конференцсервіс #mice #event #инстаеда #киев #київ #kyiv #kiev #vsco #vscoua #vscoukraine #отдых #ресторан #decoraton  #restaurante #restaurant #restaurants  #fancy #rich #hotels #charm #charme
#Лєда_Компанія  . Готельно-ресторанний комплекс "Козацький стан" це чудове місце для відпочинку у вихідний день! Особливо, коли вся країна святкує День Конституції! . Ми щиро вітаємо усіх Українців! . #vscofood  #rest  #havingrest  #vscocam  #nature  #козацькийстан  #природа  #конференцсервіс  #mice  #event  #инстаеда  #киев  #київ  #kyiv  #kiev  #vsco  #vscoua  #vscoukraine  #отдых  #ресторан  #decoraton   #restaurante  #restaurant  #restaurants   #fancy  #rich  #hotels  #charm  #charme 
Our hotel rooms are well equipped to help you spend an amazing vacation! Get your phone and computer off, enjoy our comfortable beds and beautiful beach, just 5 m away from your room!
***
Naše hotelske sobe su jako dobro opremljene kako biste proveli što ugodniji odmor! Ugasite telefone i kompjutere i uživajte u našim udobnim krevetima i sjajnoj plaži, udaljenoj samo 5 m od vaše sobe. 
#WellnessWednesday #hotelpalma #beachtime #beachlife #summer2017 #hotels #primorjehotels #tivat #montenegro #relax
Our hotel rooms are well equipped to help you spend an amazing vacation! Get your phone and computer off, enjoy our comfortable beds and beautiful beach, just 5 m away from your room! *** Naše hotelske sobe su jako dobro opremljene kako biste proveli što ugodniji odmor! Ugasite telefone i kompjutere i uživajte u našim udobnim krevetima i sjajnoj plaži, udaljenoj samo 5 m od vaše sobe. #WellnessWednesday  #hotelpalma  #beachtime  #beachlife  #summer2017  #hotels  #primorjehotels  #tivat  #montenegro  #relax 
How stunning is this hotel? The Park Hotel in Diss, Norfolk have generously donated a nights stay for two people with breakfast on Friday 22nd September or any Sunday in September. 
And @something_to_look_forward_to are tagging on a £60 gift voucher for a couple affected by breast cancer.

#Norfolk #diss #hotel #hotels #couplegoals #couplesgoals #cancer #charity #somethingtolookforwardto #relax #break #holiday #projectbedfordshireandluton #breastcancer
Summer mood is settling in. And Bali must be on most bucket lists.
Summer mood is settling in. And Bali must be on most bucket lists.
#insideoberoi is all about sharing our favourite little details and all the beautiful details that make up our hotel.
#insideoberoi  is all about sharing our favourite little details and all the beautiful details that make up our hotel.
Backstage "seduluran selawase alumni SMP 10 angkatan 91" #stage #happy #blue #white reunion #smp #eo #alhamdulillah #feelings #trip #work #workout #job #heavy #passion #red #spirit #love #happy #semarang #indonesia #rain #world #mensfashion #water #me #dangdut #dance #goyang #melayu #hotels #hotel @spense.family
I B I Z A🏝 
Visiting new places and meet up with lovely people

Cant wait to meet Roze&Pierre @losenamoradosibiza and chill out with my bestie @badatsoraya 
#losenamoradosibiza#hotels#hotellovers#hotelblogger#portinatx#ibiza#charminghotel#hippiechic#hippiestyle#decoration#bohostyle#ethnicstyle#chill#funtimes#island#islandliving#islandgirl#fashion#fashionblogger#fashionstyle
Ai lên Bà Nà tui dắt đi chơi,suốt ngày đi có một mình#hotels #vsco #intagram #camera #43 #360plus5 #barbershopconnect #baby
Located in the quarter where #Caravaggio spent much of his time working as well as carousing, the Church of St. Louis of the French, only 5 minutes from #hoteladriano, contains a sequence of the life of St. Matthew.
#hoteladriano
Located in the quarter where #Caravaggio  spent much of his time working as well as carousing, the Church of St. Louis of the French, only 5 minutes from #hoteladriano , contains a sequence of the life of St. Matthew. #hoteladriano 
Cavo Tagoo ♥️
📸 @michutravel
•••
#hotels #hotel #travel #travelling #cavotagoo #greece #goodlife #santorini
Are you always on time for your #gig ?

Live in #Spain, how was your kids #graduation?

Snip of #ExpatSingerAdvice Vlog 68:
https://youtu.be/S6yiG0rBCuo

Tunes by @devoneddymusic
he's awesome, check him out here:
https://youtu.be/3Y7PQY-hwZ0

#hotel
#Lanzarote 
#expat 
#goodtimes
#Expats 
#Singer
#Advice 
#SocialMedia 
#YouTuber
#Spain 
#Youtube
#Vlog 
#giglife
#Sing 
#Gig 
#Gigs 
#Gigging 
#Show 
#Stage
#Hotels 
#Bars
#singers
#singersongwriter
#singerlife
Are you always on time for your #gig  ? Live in #Spain , how was your kids #graduation ? Snip of #ExpatSingerAdvice  Vlog 68: https://youtu.be/S6yiG0rBCuo Tunes by @devoneddymusic he's awesome, check him out here: https://youtu.be/3Y7PQY-hwZ0 #hotel  #Lanzarote  #expat  #goodtimes  #Expats  #Singer  #Advice  #SocialMedia  #YouTuber  #Spain  #Youtube  #Vlog  #giglife  #Sing  #Gig  #Gigs  #Gigging  #Show  #Stage  #Hotels  #Bars  #singers  #singersongwriter  #singerlife 
Hallway envy! 💛👌🏼
#villagestores #villagetoday
••
📷 via #pinterest
••
Addicted? Need more inspiration? Visit us in stores & online for all your interior decorating needs!
••
Follow the link in our bio, or visit:
www.villagestores.com.au
Hallway envy! 💛👌🏼 #villagestores  #villagetoday  •• 📷 via #pinterest  •• Addicted? Need more inspiration? Visit us in stores & online for all your interior decorating needs! •• Follow the link in our bio, or visit: www.villagestores.com.au
View from the Rooftopbar Hotel  The Paul in New York#empirestatebuilding #nyc #newyork #unitedstatesofamerica #hotels#thepaul
With our lady in red, exploring the streets of the French Riviera 🥀 via @belenhostalet || Grasse, French Riviera #mercitravels
With our lady in red, exploring the streets of the French Riviera 🥀 via @belenhostalet || Grasse, French Riviera #mercitravels 
#POPCAKE #pancakes are served in over 25 countries!  Join the #pancake revolution! #hotels #hospitality #getintouch #breakfast #buffet
Spend a #romantic #weekend away at Monachyle Mhor Hotel in Balquhidder, Scotland this #summer. With #stunning #views and #great #food. Check out Monachyle Mhor on our website this week. Our Editor's Choice @themhorcollection #summer2017 #sun #scotland #travel #charming #small #hotels #trips #hotelstay #explore #rooms #roomgoals #roomdecor #roomdesign
Spend a #romantic #weekend away at Monachyle Mhor Hotel in Balquhidder, Scotland this #summer. With #stunning #views and #great #food. Check out Monachyle Mhor on our website this week. Our Editor's Choice @themhorcollection #summer2017 #sun #scotland #travel #charming #small #hotels #trips #hotelstay #explore #rooms #roomdecor #roomgoals #roomdesign
Spend a #romantic #weekend away at Monachyle Mhor Hotel in Balquhidder, Scotland this #summer. With #stunning #views and #great #food. Check out Monachyle Mhor on our website this week. Our Editor's Choice @themhorcollection #summer2017 #sun #scotland #travel #charming #small #hotels #trips #hotelstay #explore #rooms #charmingtravel #bed #roomgoals #roomdecor #roomdesign
Spend a #romantic #weekend away at Monachyle Mhor Hotel in Balquhidder, Scotland this #summer. With #stunning #views and #great #food. Check out Monachyle Mhor on our website this week. Our Editor's Choice @themhorcollection #summer2017 #sun #scotland #travel #charming #small #hotels #trips #hotelstay #explore #rooms
Prepara tu equipaje!
Porque "en el campo, la vida es más sabrosa"... :)
•
•
•
•
•
#Artesa #vacaciones #verano #resort #spa #hotel #apartamento #rural #hotels #massage #lujo #sala #ruralexploration #footing #farm #rural_love #asylum  #españa #agosto #verano2017 #casa #sol #facial #resort #spa #hotel #apartamento #campo #hotels #massage #relax
Worldwidetravelarrangements is a page for unique destinations around the world filled with so much excitement, from luxury hotels, villas to the most amazing excursion. 
Enjoy priceless moments creating nothing but new memories with families, friends or even a loved one. This page has everything you need. Any questions that you may not know before travel asks us and we can answer it for you. Let's spears the travel knowledge across the globe.

#Luxury #Travel #Industry #Hotels #Holidays #International #Destinations #Airlines #Touristboards #LuxuryCollections #Aviation #TravelIndustry #CabinCrew #UpperClass #BusinessClass #International #Recommendation #TravelMagazine #Aircrafts #Countries #Europe #Asia #Africa #BusinessTravel #HoneyMoons #CityBreaks #BeachHoliday #Europe #TravelMagazine
Worldwidetravelarrangements is a page for unique destinations around the world filled with so much excitement, from luxury hotels, villas to the most amazing excursion. Enjoy priceless moments creating nothing but new memories with families, friends or even a loved one. This page has everything you need. Any questions that you may not know before travel asks us and we can answer it for you. Let's spears the travel knowledge across the globe. #Luxury  #Travel  #Industry  #Hotels  #Holidays  #International  #Destinations  #Airlines  #Touristboards  #LuxuryCollections  #Aviation  #TravelIndustry  #CabinCrew  #UpperClass  #BusinessClass  #International  #Recommendation  #TravelMagazine  #Aircrafts  #Countries  #Europe  #Asia  #Africa  #BusinessTravel  #HoneyMoons  #CityBreaks  #BeachHoliday  #Europe  #TravelMagazine 
Twisting Courtyard by ARCHSTUDIO
link on bio
.
“Twisting courtyard is located in Paizihutong, Dashilar Area, Beijing. It used to be a Siheyuan with one single entry. The purpose of the improvement is to upgrade the necessary infrastructure needed for modern life, thus turning this traditional courtyard, which mainly serve as a residence, into an attractive public space of Beijing Inner City.”
.
#thedescriber #ARCHSTUDIO #TwistingCourtyard #Architecture #design #China #furniture #contemporary #renovation #space #contemporaryarchitecture #interiordesign #temple #hotels #art #escapes #travelgram #travel #boutiquehotel #travelers #cruise #archdaily #architecturelovers #dailyprojects
Twisting Courtyard by ARCHSTUDIO link on bio . “Twisting courtyard is located in Paizihutong, Dashilar Area, Beijing. It used to be a Siheyuan with one single entry. The purpose of the improvement is to upgrade the necessary infrastructure needed for modern life, thus turning this traditional courtyard, which mainly serve as a residence, into an attractive public space of Beijing Inner City.” . #thedescriber  #ARCHSTUDIO  #TwistingCourtyard  #Architecture  #design  #China  #furniture  #contemporary  #renovation  #space  #contemporaryarchitecture  #interiordesign  #temple  #hotels  #art  #escapes  #travelgram  #travel  #boutiquehotel  #travelers  #cruise  #archdaily  #architecturelovers  #dailyprojects 
Le Five Annemasse présente son premier tournoi réservé aux hôteliers et restaurateurs !! Le mercredi 19 Juillet à partir de 15h !! Montez une team de 5 à 7 joueurs et devenez la meilleure team hôtelière/restaurateur de la région !! A vos agendas !! #lefive #hotels #palace #restaurants #fastfood #foot5
Le Five Annemasse présente son premier tournoi réservé aux hôteliers et restaurateurs !! Le mercredi 19 Juillet à partir de 15h !! Montez une team de 5 à 7 joueurs et devenez la meilleure team hôtelière/restaurateur de la région !! A vos agendas !! #lefive  #hotels  #palace  #restaurants  #fastfood  #foot5 
Game Haven Lodge - “Chimwenya Private Game Park - 500 Acres
Just 25 Kilometers from Blantyre's CBD on the Thyolo Road
Game Drives, Nature Walks, Mountain Biking, Fishing, Children’s Playground, Golf, Accommodation, Restaurant and so much more. 
There's Something for Everyone.
More info: http://ow.ly/UfB230d0CTf
#bizmalawi #malawi #gamehavenlodge #hotels #lodge #safarilodges #chimwenyaprivategamepark  #chimwenyaprivategameparkmalawi