an online Instagram web viewer

#legday medias

Photos

How to get a Girl to do Cardio😂😂
@aesthetic_squats
-
@justsul @bahijkaddoura @supercarblondie @piques
How to get a Girl to do Cardio😂😂 @aesthetic_squats - @justsul @bahijkaddoura @supercarblondie @piques
Left or right 🙌
Via @aesthetic_workout
-
-
@mylesleask
Left or right 🙌 Via @aesthetic_workout - - @mylesleask
Training with @enduranceparkour at @apexlouisville. We worked on a couple fun things, check the link in my bio to see what went down!
Training with @enduranceparkour at @apexlouisville. We worked on a couple fun things, check the link in my bio to see what went down!
Posterior com a melhor #personaltrainer @alyneslyn 👊🏻👊🏻👊🏻 #musculação #legday #posteriores #treinododia @competitionacademia
Min rumpa har alltid varit så platt. Men nu börjar den juh faktisk att få lite form. 😁 #aimntribe #workoutwear #ifkperformancecenter #hammerstrength #workoutmotivation #staystrong #motmintoppform #fitmom #strong #legday
AMRAP testing day. 355 x 5 squat, 280 x 7 bench and 405 x 7 deadlift. Got a telemarketer call during deadlift 🤬 so my man recording had to decline the call and start recording again quick.
AMRAP testing day. 355 x 5 squat, 280 x 7 bench and 405 x 7 deadlift. Got a telemarketer call during deadlift 🤬 so my man recording had to decline the call and start recording again quick.
Checking out this foam rolling business ➡️ next pic, monkey see monkey do. #foamrolling #ouch #teamleman #legday #20weekchallenge
Yes im.eat out a lot, but Like my trainer always says--> ONE "bad meal" won't make you FAT, like ONE "good meal" won't make you FIT! no guilt! 💅
.
.
.
.
#yummers #foodie #pescatarian #goodeats #healtylife #wolfgangpuck
#fitchicks #fitspo #fitnessgoals #SILHOUETTEBODY #fitfam #healtylife #absworkout #fitnessmotivation #sexy #bombshell #bodygoals #LEGDAY #abs #sixpack #squats #glutesworkout #godblessthegym #savage #beachbody
Soooooo he woke me up saying he cant sleep🤦🏻‍♀️, I got up and headed for a training session to only come back to all of them three still sleeping? Life is not fair🤣, but #bepositive #momlife #girlswholift #strongwomen #legday #squats #deadlifts #gym #gymlife #gymgirl #bodybuilding #fitgirl #fitness #instafit #fitmom #trainhard #bikiniprep #muscle #myproteinleggings #strongnotskinny #glutes
Long way from being the quadfather. 
But it's comin together.

#legday #quads
Long way from being the quadfather. But it's comin together. #legday  #quads 
The Fan Bang: You tease your bangs.. Spray with Aqua Net.. Blow dry.. Spray again.. Blow dry.. Ah, the 90's. My hair length went past my shoulders but the back was put up in a French Roll updo. This photo was taken at a dance. I was 14 years old. ❤️ #teenager #teamnatural #pixiecut #hair #curlyhair #shorthair  #bodygoals #snapchat #fit #fitgang #actress #dtla #la #model #workout #curlyhair #legday #photoshoot  #fashion #blasian #photography #style #slim #black
#slimthick #fitchick #photographer #herbalife #blasian #content #body #beforeandafter
The Fan Bang: You tease your bangs.. Spray with Aqua Net.. Blow dry.. Spray again.. Blow dry.. Ah, the 90's. My hair length went past my shoulders but the back was put up in a French Roll updo. This photo was taken at a dance. I was 14 years old. ❤️ #teenager  #teamnatural  #pixiecut  #hair  #curlyhair  #shorthair  #bodygoals  #snapchat  #fit  #fitgang  #actress  #dtla  #la  #model  #workout  #curlyhair  #legday  #photoshoot  #fashion  #blasian  #photography  #style  #slim  #black  #slimthick  #fitchick  #photographer  #herbalife  #blasian  #content  #body  #beforeandafter 
2 days in a row!?! Something strange is going on 💪😉🤣 #legday#lovepink
#reebok#craftsportswear#ghostbusters#egoboost#urkraftsgym
Last @saccyclocross race of the season was today and it was the most fun I’ve had in a while. Yes, I am wearing a festive velvet crop top with bibs. And yes, that is also a miniature Santa hat in between my brand new helmet ears. I’m a trendsetter. You’re welcome. 🌲💕🚲 #cxct #cyclocrosscroptop #hashtagbynotteriyaki #cx #cyclocross #saccx #cyclist #cycling #bike #bikes #bikelife #fitness #stiggiesmalls #santacruzbikes #outsideisfree #legday #velvetcroptop #festive #trendsetter #babesonbikes #sacramento #california #fitgirl #sober #happiness #zipp
Last @saccyclocross race of the season was today and it was the most fun I’ve had in a while. Yes, I am wearing a festive velvet crop top with bibs. And yes, that is also a miniature Santa hat in between my brand new helmet ears. I’m a trendsetter. You’re welcome. 🌲💕🚲 #cxct  #cyclocrosscroptop  #hashtagbynotteriyaki  #cx  #cyclocross  #saccx  #cyclist  #cycling  #bike  #bikes  #bikelife  #fitness  #stiggiesmalls  #santacruzbikes  #outsideisfree  #legday  #velvetcroptop  #festive  #trendsetter  #babesonbikes  #sacramento  #california  #fitgirl  #sober  #happiness  #zipp 
That arm pump is real! Even though I didn't do arms today. Happy Saturday!!
.
.
.
# #gym #gymlife #gymtime #fit #fitfam #fitpro #fitness #fitlife  #workout #health 
#healthy #eatclean #mealprep #hardwork #muscle #shredded #legday #abs #training #aesthetics #physique #dedication #instafit #fitspo #motivation
Squat Workout After Work I Love My Job N The Peeps I Work With. Felt Amazing To Workout I Been Taking a Break Due To My Legs Hurting But Now It’s Back To The Grind Especially When I Got My BFF Right Next To Me I Love You Ryan Chaffee 
I’m Now Down 138lbs 14lbs To Go Till I Reach My Goal Weight 125lbs... Kaylea & Jeremy And Makaila Had Lots Of Working Out With You Guys Even Though We We’re All Doing Are Own Thing.. Follow My Journey —-> BossLadyFit

#ECA #ECALIFE #ECARESULTS #ECAFIT #Bikini #Competition2018 #FitFamily #LegDay #WeLift #FitnessMotivation #WeightLossJourney #NoExcuses
Squat Workout After Work I Love My Job N The Peeps I Work With. Felt Amazing To Workout I Been Taking a Break Due To My Legs Hurting But Now It’s Back To The Grind Especially When I Got My BFF Right Next To Me I Love You Ryan Chaffee I’m Now Down 138lbs 14lbs To Go Till I Reach My Goal Weight 125lbs... Kaylea & Jeremy And Makaila Had Lots Of Working Out With You Guys Even Though We We’re All Doing Are Own Thing.. Follow My Journey —-> BossLadyFit #ECA  #ECALIFE  #ECARESULTS  #ECAFIT  #Bikini  #Competition2018  #FitFamily  #LegDay  #WeLift  #FitnessMotivation  #WeightLossJourney  #NoExcuses 
Apparently this outfit makes me look like one of those “fit moms” according to my friend🤦🏻‍♀️ I liked it tho so 💁🏻‍♀️😂🌸 #LegDay #Saturdays #Legs #TwoADay #24HourFitness #FitFam #Adidas #Chucks #Booty #Cardio #Core #Fitness #Happy #PositiveVibes #StrongIsSexy #PutInTheWork #Gainsmas #FollowMe #GirlsWhoLift #RealBootyGains
Shameless Gym Selfie #legday #gym #gymfit #muscle #gunsout
Perfection😍 @onlygoodstaf.
.
.
.
📸 @veradijkmans
Perfection😍 @onlygoodstaf. . . . 📸 @veradijkmans
💥💥💥💥💥💥
FOLLOW US .
⬇️⬇️⬇️⬇️⬇️⬇️⬇️⬇️⬇️⬇️⬇️⬇️
🔥🔥@madonna_supermen🔥🔥
⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️⬆️
...
#bodybuilding #gymmemes #crossfit #strong #motivation #powerlifting #quotes #gymhumour #deadlift #squat #bench #gymhumour #funny #legday #motivation #girlswholift #fitchick #mma #gymhumor #gym #gymmotivation #gymproblems #gymflow
Anyone who knows me knows that I’ve always suffered from a severe case of chicken legs lol 🐓📌📌 after neglecting them for the last 5 years I made it a New Years resolution this year to grow some legs & I don’t think I’ve skipped a leg day this year.. still fuck all, I know, but I think they fit the rest of my body a bit better at this point 😂 #nopainnogain #sundayfunday #legday #nomoreboxgap
Anyone who knows me knows that I’ve always suffered from a severe case of chicken legs lol 🐓📌📌 after neglecting them for the last 5 years I made it a New Years resolution this year to grow some legs & I don’t think I’ve skipped a leg day this year.. still fuck all, I know, but I think they fit the rest of my body a bit better at this point 😂 #nopainnogain  #sundayfunday  #legday  #nomoreboxgap 
Kan ligesom fornemme at disse ord bliver til virkelighed 😬🤣 #legday med #debedste og #stopmedatpive 😂 #training #træning #motion #motivation #keeppushing #keepgoing #gym #fit #fitforfun #nopainnogain #walkfunnytommorow #friendsneverletfriendsskiplegday
Had a late night #gym session before bb got here. Been up since 5am but went at 930 any way. Was tired, legs quivering, but got my work out done! Also have a new skin regimen so this is a no filtered face! Not even for smoothness! 😍😍 #skingoals #goals #weightlossjourney #gym #workout #fitiger #fitig #fitigers #buttchallenge #fitness #fitnessjourney #strongnotskinny #notskinnyshaming #thic #thicc #thick #musclespleasegrow #muscles #musclesplease #squats #inprogress #healthy #cardio #legday #motivation
Had a late night #gym  session before bb got here. Been up since 5am but went at 930 any way. Was tired, legs quivering, but got my work out done! Also have a new skin regimen so this is a no filtered face! Not even for smoothness! 😍😍 #skingoals  #goals  #weightlossjourney  #gym  #workout  #fitiger  #fitig  #fitigers  #buttchallenge  #fitness  #fitnessjourney  #strongnotskinny  #notskinnyshaming  #thic  #thicc  #thick  #musclespleasegrow  #muscles  #musclesplease  #squats  #inprogress  #healthy  #cardio  #legday  #motivation 
Leg day EVERY day! Never skip leg day. #nakmuay #martialarts #muaythai #motivation #legday #sparta #skip #never
Leg day + Sunday 5K .
.
.
#legday #sunday5k
Leg day along with some cardio working in around 4+ miles. Remember to stay hydrated and be yourself and most importantly be happy 💝#legday #cardio #passion
Leg day along with some cardio working in around 4+ miles. Remember to stay hydrated and be yourself and most importantly be happy 💝#legday  #cardio  #passion 
Woah😍 @onlygoodstaf.
.
.
.
📸 @kateupton
Woah😍 @onlygoodstaf. . . . 📸 @kateupton
So this t isn’t how you use this machine but this alternate way of using it builds up the quads hamstrings and most importantly glutes  #gains #gym #ass #workinprogress #legday #straddle #legs #glutes #quads #🍑 #flexible #workout #exercise #lift #weights #doubletap #strong #fit #body #fitgirl #lifestyle #training #gymlife #fitbody #gainz #progress #journey #poledance #fitness
#legday #letdoit #
Last offseason
Weight 120kg 
264 lbs 
Training 6 times a week🏋️‍♂️
Eating 8 times a day 🍗
Greetings from 🇩🇪 Stay motivated!
Eat clean!
No excuses!

#tattooberlin
#tattoobodybuilder #protein #arms #bizeps #trizeps #fitfam #fitfangermany #fitfamgermany #fitfamberlin #legs #legday #bodybuilding #bodybuildingberlin #bodybuildinggermany #fitness #veins #followme #muskeln #muskelaufbau #massephase #guyswholift #mcfit #fitx #fitxberlin
Last offseason Weight 120kg 264 lbs Training 6 times a week🏋️‍♂️ Eating 8 times a day 🍗 Greetings from 🇩🇪 Stay motivated! Eat clean! No excuses! #tattooberlin  #tattoobodybuilder  #protein  #arms  #bizeps  #trizeps  #fitfam  #fitfangermany  #fitfamgermany  #fitfamberlin  #legs  #legday  #bodybuilding  #bodybuildingberlin  #bodybuildinggermany  #fitness  #veins  #followme  #muskeln  #muskelaufbau  #massephase  #guyswholift  #mcfit  #fitx  #fitxberlin 
Mini accomplishment 🎉🎉
I conquered the baby box today! (12 inches) It may not be the biggest height, but the idea of box jumps has always terrified me everytime I've tried!  My feet like to stay on the ground 😅 Gonna work on my ankle strength so maybe in the new year I can graduate to a bigger box 😁
.
.
.
#accomplisment #newyears #goals #smashyourgoals #strength #gymtime #boxjumps #superpowers #squats #squatbooty #squatsfordays #whatsyoursuperpower #legs #legpress #legday #quads #calves #fitnessmotivation #fitjourney #fitnessjourney #fitness #fitfam #motivate #motivation #findyourwhy #doitforyou #dontstop  #beabetteryou #strongisbeautiful
Mini accomplishment 🎉🎉 I conquered the baby box today! (12 inches) It may not be the biggest height, but the idea of box jumps has always terrified me everytime I've tried! My feet like to stay on the ground 😅 Gonna work on my ankle strength so maybe in the new year I can graduate to a bigger box 😁 . . . #accomplisment  #newyears  #goals  #smashyourgoals  #strength  #gymtime  #boxjumps  #superpowers  #squats  #squatbooty  #squatsfordays  #whatsyoursuperpower  #legs  #legpress  #legday  #quads  #calves  #fitnessmotivation  #fitjourney  #fitnessjourney  #fitness  #fitfam  #motivate  #motivation  #findyourwhy  #doitforyou  #dontstop  #beabetteryou  #strongisbeautiful 
Finally PR’d on squat again. Knees feeling better, adductors becoming stable. 245x1 on the road to 315. #squats #legs #legday #depth #booty #fitness #bodybuilding #progress #motivation
Bikini bae😍 @onlygoodstaf.
.
.
.
📸 TAG model please
Bikini bae😍 @onlygoodstaf. . . . 📸 TAG model please
Lightweights today don’t know why it went sideways. 🙂 #squats #workout #workout #workoutmotivation #legday #quads
Posing in itself can be seen as a workout..Thanks @killinitkatee for the great shots today 💯#legendary #legday #aesthetics #cali #npc #ifbb #bodybyo #otomix #wbff #musclemania #fitnessmodel #fitspiration #worldgym #symmetry
Felt good to be back and on my grind 🙏🏻✨
Felt good to be back and on my grind 🙏🏻✨
‎تمارين ممتازه لشد اسفل الظهر والارداف و المعده السفليه👍🏽👍🏽 ‏#fitness #fitfam #fitsporation ‏#bodybuilding #exercise #gym #gymlife #gymrat #shoutout #ripped #NPC #healthy #mazen_aboud#model#abs #mcm #تصميمي #تصويري #صحة #شباب #رجيم #دايت #workout #muscle #motivation#sport #instafit#رشاقة #رياضة
‏.#LEGDAY
My Hometown clique #FormulaNation
Two-a-days for me today. Glutes and chest! Feeling really good, but definitely ready for bed. 
Glue workout: 
4x12 banded hip thrusts.
4x15 banded squats
4x12 straight leg deadlifts
4x 15 side lunges
4x12 single leg hip thrusts
4x15 single leg straight leg deadlifts.
Let me know if you have any questions with the workout!  #bootypump #booty #gym #gymlife #gymtime #fit #fitfam #fitpro #fitness #fitlife  #workout #health 
#healthy #eatclean #mealprep #hardwork #muscle #shredded #legday #abs #training #aesthetics #physique #dedication #instafit #fitspo #motivation #fitgirl
Two-a-days for me today. Glutes and chest! Feeling really good, but definitely ready for bed. Glue workout: 4x12 banded hip thrusts. 4x15 banded squats 4x12 straight leg deadlifts 4x 15 side lunges 4x12 single leg hip thrusts 4x15 single leg straight leg deadlifts. Let me know if you have any questions with the workout! #bootypump  #booty  #gym  #gymlife  #gymtime  #fit  #fitfam  #fitpro  #fitness  #fitlife   #workout  #health  #healthy  #eatclean  #mealprep  #hardwork  #muscle  #shredded  #legday  #abs  #training  #aesthetics  #physique  #dedication  #instafit  #fitspo  #motivation  #fitgirl 
Last check 
Training 6 times a week🏋️‍♂️
Eating 8 times a day 🍗
Greetings from 🇩🇪 Stay motivated!
Eat clean!
No excuses!

#tattooberlin
#tattoobodybuilder #protein #arms #bizeps #trizeps #fitfam #fitfangermany #fitfamgermany #fitfamberlin #legs #legday #bodybuilding #bodybuildingberlin #bodybuildinggermany #fitness #veins #followme #muskeln #muskelaufbau #massephase #guyswholift #mcfit #fitx #fitxberlin
strong 😎
FOLLOW FOR FOLLOW GAME ON 
FOLLOW ME TO GET FOLLOWED BACK 
INSTANT FOLLOWERS
FREE SHOUTOUT
IF YOU UNFOLLOW THAN EVENTUALLY YOU WILL GET UNFOLLOWED
#hardworkpaysoff#workout#training#ripped#ifbb#physique #abs#aesthetic #sixpack #shredded #strong#staystrong #squats #fitness #fitnessmotivation #fitnessaddict #flex#gymrat#gymlife#grind #gains#legday #gym#bodybuilder #bodybuilding #beastmode #nevergiveup #noexcuses #muscle #motivation @instagram @schwarzenegger @therock @vindiesel @thenotoriousmma @danbilzerian @cristiano @leomessi @neymarjr @nike
strong 😎 FOLLOW FOR FOLLOW GAME ON FOLLOW ME TO GET FOLLOWED BACK INSTANT FOLLOWERS FREE SHOUTOUT IF YOU UNFOLLOW THAN EVENTUALLY YOU WILL GET UNFOLLOWED #hardworkpaysoff #workout #training #ripped #ifbb #physique  #abs #aesthetic  #sixpack  #shredded  #strong #staystrong  #squats  #fitness  #fitnessmotivation  #fitnessaddict  #flex #gymrat #gymlife #grind  #gains #legday  #gym #bodybuilder  #bodybuilding  #beastmode  #nevergiveup  #noexcuses  #muscle  #motivation  @instagram @schwarzenegger @therock @vindiesel @thenotoriousmma @danbilzerian @cristiano @leomessi @neymarjr @nike
Sometimes less is more.
Sometimes less is more.
You make my knees feel weak. 
Just kidding😛.
Yesterday was Leg Day. 
Video Credit- @vintage_for_life_7

#weightloss #goals #weightlossjourney #dietbet #fattofit #obesetobeast #beastmode #fitfam #motivation #december #health #diet #progress #fit #gym #anytimefitness #work #hustle #grind #tgif #workout #cardio #legday #sweat #gymlife #fitness #fitnessmodel #healthy #instahealth #squats
Lower body workout from earlier this week
.
➕KB sumo squats
➕cable kickbacks
➕Smith machine lunges (front foot elevated)
➕DB deadlifts
➕DB hamstring curls
.
Easier recording this time as I had bae getting all the good angles 😘 excuse my form on the lunges - I need to work on that!
.
#workout #workoutvideo #legday #squats #progress #instafitness #sohappy #strongisthenewskinny #girlswholift #gains #instafit #quads #fitchicks #fitfam #fitnessinspiration #fitnessmotivation #goalchaser #determined #becomebetter #squatbooty
Lower body workout from earlier this week . ➕KB sumo squats ➕cable kickbacks ➕Smith machine lunges (front foot elevated) ➕DB deadlifts ➕DB hamstring curls . Easier recording this time as I had bae getting all the good angles 😘 excuse my form on the lunges - I need to work on that! . #workout  #workoutvideo  #legday  #squats  #progress  #instafitness  #sohappy  #strongisthenewskinny  #girlswholift  #gains  #instafit  #quads  #fitchicks  #fitfam  #fitnessinspiration  #fitnessmotivation  #goalchaser  #determined  #becomebetter  #squatbooty 
A day at the gym #legday#glutesday Not a pro. Don’t judge.
Can’t believe this was 4 years ago! CrossFit Total at Sin City 2013. 
How the time (and weight) flies. Although, after taking 6 months off who knows if I can even hit this weight 😂 -

@cheahjohn remember when we were just praying we could string double unders together on comp day?? 😂 - 📸: @mick125
Can’t believe this was 4 years ago! CrossFit Total at Sin City 2013. How the time (and weight) flies. Although, after taking 6 months off who knows if I can even hit this weight 😂 - @cheahjohn remember when we were just praying we could string double unders together on comp day?? 😂 - 📸: @mick125
Forever grateful for the progress you make ❤ #pda
•
•
#fit #fun #fitness #gym #workout #fitfam #muscle #grind #hustle #gains #fitspo #instafit #fitspo #fitsporation #love #ootd #picoftheday #lucky #arms #legday #musclerepublic #mscr #instafit #instagood #partner #happy #happyplace #young #free #smile
Danny!! 🤣🤣🤣 what is you doin' baby!!!??? #legday #fun #fitnessmotivation #gymhumor #inspire #dreambig #calves #grow #develop #improve #gains #goals
Clique
Clique